DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and chst9l.4

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_012825151.2 Gene:chst9l.4 / 101730847 XenbaseID:XB-GENE-22169235 Length:298 Species:Xenopus tropicalis


Alignment Length:282 Identity:82/282 - (29%)
Similarity:135/282 - (47%) Gaps:48/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RSEHLAAVCDRYKLQEKY----PPNPWEFFVSPGHNNLVWCNVFKAASSTWM------------- 178
            |::.|.:.|.:..|.:.:    |......||...|..:: |.|.|...:.|.             
 Frog    47 RTKLLKSACQQSNLSKPFGRMSPFVARSLFVEQKHKFII-CAVPKVGCTNWKRIILLLKLNLSTE 110

  Fly   179 YYFNILAGYDVKYLQRTETQPLELARKRFPRPELGELMELLPSALSFLFVRDPFERILSAYRNKL 243
            .:|...|.::..:|:|....|.:..|.            :|.:....:|.|.||:||:||||:|.
 Frog   111 VHFEHNAIHESAFLKRLSDYPADQQRM------------MLTNYTKVMFTRHPFQRIVSAYRDKF 163

  Fly   244 EGNKNTFYKALGNKIVHRYRKRNLGGPWPRCGPTFEEFVRFLIAEHAAGKRFDEHWAPVYSFCTP 308
            . :...:||.:.|.|..:.||.|...|     .||:|||::::.:  .....|.||.|::..|.|
 Frog   164 L-HPGDYYKHIANIIKSQVRKVNTPEP-----VTFKEFVQYIVQQ--VPTWLDIHWMPMHLLCDP 220

  Fly   309 CSVNFTIIGKTETFQRDSEFIIRQAGLESLLLGLGKLPQRKQRKIGNQARSGVKSEALVERYFAD 373
            |::|:.|:||.||.:|||:.:::..|..|.|    |.|:.||.   |::|:...   :|::||:.
 Frog   221 CNINYNILGKFETLKRDSDQVLKTIGAPSNL----KYPELKQY---NESRTDTN---IVDKYFST 275

  Fly   374 LDRSTLDQLLKIYRIDFELFDY 395
            |..:.||.|:|:|..||.||.|
 Frog   276 LPLNVLDLLVKLYNHDFMLFGY 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 74/247 (30%)
chst9l.4XP_012825151.2 Sulfotransfer_2 80..297 CDD:397568 74/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.