DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and LOC100536144

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_021326538.1 Gene:LOC100536144 / 100536144 -ID:- Length:345 Species:Danio rerio


Alignment Length:328 Identity:94/328 - (28%)
Similarity:143/328 - (43%) Gaps:71/328 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 YSEELHSRTERELQRRSEH-------LAAVCDRYKLQEK------YPPNPWEFFVSPGHNNLVWC 167
            |.....|:....|:||..|       |.|.......:||      .|.:.....:...|:.:::|
Zfish    34 YLHMASSKDPTHLKRRQAHRKHRIRELCAANSSLHFKEKSFTFDQIPDSSLNNLIVDDHHRVIYC 98

  Fly   168 NVFKAASSTW---MYYF--NILAGYDVKYLQRTETQPLELARK---------------RFPRPEL 212
            .|.|.|.:.|   |:..  |:.|.....||...:. |||:...               |:.||  
Zfish    99 YVPKVACTNWKRVMFALSQNLKAPDGAPYLDPLDI-PLEIIHNSTVHNTFKKLWMRHGRYARP-- 160

  Fly   213 GELME-LLPSALSFLFVRDPFERILSAYRNKLEGNKNTFYKALGNKIVHRYRKRNLGGPWP---- 272
              ||| .|.:...||||||||.|::||||:|.......:|...|:.|:.||  .|:..| |    
Zfish   161 --LMEQKLKNYTKFLFVRDPFVRLISAYRDKFVELNEYYYSDFGSMILQRY--ANISQP-PTSAQ 220

  Fly   273 ---RCG--PTFEEFVRFLIAEHAAGKR-FDEHWAPVYSFCTPCSVNFTIIGKTETFQRDSEFIIR 331
               |.|  |:|..|:::|:......:. |||||..::..|.||.:::..|||.||...|:|.:::
Zfish   221 EAFRAGIRPSFTHFIKYLLDPQTEKEEPFDEHWQQIHRLCHPCQIDYDFIGKLETLDEDTEHLLK 285

  Fly   332 QAGLESLLLGLGK---LPQRKQRKIGNQARSGVKSEALVERYFADLDRSTLDQLLKIYRIDFELF 393
                   :|||.|   .|.      |.:.|:.|..|   :.:||::..:...:|..:|..||:||
Zfish   286 -------ILGLDKHIHFPP------GYENRTAVDWE---QEWFANISLADRRELYSLYETDFKLF 334

  Fly   394 DYD 396
            .||
Zfish   335 GYD 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 81/268 (30%)
LOC100536144XP_021326538.1 Sulfotransfer_2 90..336 CDD:308913 81/269 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.