DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and LOC100497654

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_002938892.1 Gene:LOC100497654 / 100497654 -ID:- Length:298 Species:Xenopus tropicalis


Alignment Length:203 Identity:44/203 - (21%)
Similarity:81/203 - (39%) Gaps:51/203 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 PRP----ELGELMELLPSALSFLFVRDPFERILSAYRNKLEGNKNTFYKALGNKIVHRYRKRNLG 268
            |.|    .|..|.::..|....|.:||||||::|:|.....|.                      
 Frog   134 PNPLSAYNLSMLEKVFQSYTKVLLIRDPFERLVSSYLQDSAGE---------------------- 176

  Fly   269 GPWPRCGPTFEEFVRFLIAEHAAGKRFDEHWAPVYSFCTPCSVNFTIIGKTETFQRDSEFIIRQA 333
                   .||::|:...:.:.....  |..|.|:...|.||.:.:..|.|.:.|..:...::::.
 Frog   177 -------VTFDKFLEDGLTDGPGDG--DGSWTPIVFLCHPCFIRYDYIVKYDFFNTEVLHLMKRM 232

  Fly   334 GL-ESLLLGLGKLPQRKQRKIGNQARSGVK--SEALVERYFADLDRSTLDQLLKIYRIDFELFDY 395
            || ||.|..|         .:.|.:....|  :|.|::.    :.:..::|:::||..|||.|.:
 Frog   233 GLPESALAPL---------LVDNGSMWAYKWLNENLLQL----VTKEHIEQIIEIYSWDFEAFPF 284

  Fly   396 DYRRYYDM 403
            ....::::
 Frog   285 KISSFWNI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 44/193 (23%)
LOC100497654XP_002938892.1 Sulfotransfer_2 <137..284 CDD:389992 42/190 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.