DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and chst14

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_004917361.1 Gene:chst14 / 100496179 XenbaseID:XB-GENE-1008667 Length:371 Species:Xenopus tropicalis


Alignment Length:319 Identity:83/319 - (26%)
Similarity:143/319 - (44%) Gaps:50/319 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 SQAAAPPPPPPATTLNPVYEYSEELHSRTERELQRRSEHLAAVCDRYKLQEKYPPNPWEFFVSPG 160
            ::...|||.......:.....|.|:.....|:::.|:  |.:||    .|...|.:.|:...|..
 Frog    72 AEVKTPPPRGDLVWRSRAAGESAEMEHHILRDIRNRT--LRSVC----AQRNMPHSIWQLPASQR 130

  Fly   161 HNNL-----------VWCNVFKAASSTWMYYFNILAG----YDVKYLQRTETQPLELARKRFPRP 210
            ...|           ::|.|.|.|.|.|.....:|.|    .|||.....::..:.||       
 Frog   131 RTLLKHILVSDKYRFLYCYVPKVACSNWKRVLKVLGGSLPSTDVKLKMDHKSDLVFLA------- 188

  Fly   211 ELG--ELMELLPSALSFLFVRDPFERILSAYRNKLEGNKNTFYKALGNKIVHRYRKRNLGGPWPR 273
            :|.  |:...|.....|:|||:|.||:|||||||. |....:.:..|.:|:.||||:  ||....
 Frog   189 DLSAEEVRYRLRHYYKFMFVREPMERLLSAYRNKF-GEIKEYQQRYGVEIIRRYRKQ--GGSSAG 250

  Fly   274 CGPTFEEFVRFLIAEHAAGKRFDEHWAPVYSFCTPCSVNFTIIGKTETFQRDSEFIIRQAGLESL 338
            ...||.||:.:|:.|..  :|.:|||.|:|:.|.||::.:..||..|..:.|:.:::::......
 Frog   251 DDVTFPEFLHYLLDEDP--ERMNEHWMPIYNLCQPCALTYDFIGSYERLREDANYVLQRVKAPPF 313

  Fly   339 LLGLGKLPQRK--QRKIGNQARSGVKSEALVERYFADLDRSTLDQLLKIYRIDFELFDY 395
            :    :.|:|:  .:.:..:::         :.:..:..:..:.:||..|.:||.||.|
 Frog   314 I----QFPERQAWYKPVTRESQ---------DYFLCNTPKGLIRELLPKYIMDFSLFAY 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 68/253 (27%)
chst14XP_004917361.1 Sulfotransfer_2 140..359 CDD:367564 67/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.