DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and chst11

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_012813925.1 Gene:chst11 / 100125190 XenbaseID:XB-GENE-955998 Length:352 Species:Xenopus tropicalis


Alignment Length:311 Identity:89/311 - (28%)
Similarity:146/311 - (46%) Gaps:51/311 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 EELHSRTEREL-------QRRSEHLAAVCDRYKLQEK----YPPNPWEFFVSPGHNNLVWCNVFK 171
            :||::.|:.:|       |.|.:.:..:|....:..:    ..||..:..|....:.:::|.|.|
 Frog    61 QELYNPTQLDLSSNAILHQMRRDQVTDLCRANSVMSRKRRVLTPNDLKHLVVDEDHEMIYCYVPK 125

  Fly   172 AASSTWMYYFNILAGYDVKYLQRTETQPLELAR---------KRFPRPELGELMELLPSALSFLF 227
            .|.:.|.....:|.|.. ||     :.|:|:..         |...:..:.|:...|.:.:.|||
 Frog   126 VACTNWKRVMMVLTGRG-KY-----SDPMEIPANVAHVSSNLKTLNQYSIPEINHRLKNYMKFLF 184

  Fly   228 VRDPFERILSAYRNKLEGNKNT-FYKALGNKIVHRYRKR------NLGGPWPRCGPTFEEFVRFL 285
            ||:||||::||||||.....|| |:|..|.|||.|.||.      :.|.     ...|||||.:|
 Frog   185 VREPFERLVSAYRNKFTQKYNTSFHKRYGTKIVRRQRKNATQEALHNGN-----DVKFEEFVAYL 244

  Fly   286 IAEHAAGKR-FDEHWAPVYSFCTPCSVNFTIIGKTETFQRDSEFIIRQAGLESLLLGLGKLPQRK 349
            |..|...:. |:|||..|:|.|.||.:::.:|||.||.:.||.:::..||:...|          
 Frog   245 IDPHTQKEEPFNEHWQTVFSLCHPCHIHYDLIGKYETLEEDSNYVLHLAGVGDYL---------- 299

  Fly   350 QRKIGNQARSGVKSEALVERYFADLDRSTLDQLLKIYRIDFELFDYDYRRY 400
              |....|:|...::.:...:|.::......||.::|::|:.:|:|....|
 Frog   300 --KFPTFAKSTRTTDEMTAEFFQNISSEHQMQLYEVYKLDYLMFNYSMPSY 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 77/251 (31%)
chst11XP_012813925.1 Sulfotransfer_2 113..343 CDD:367564 77/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.