DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and bZIP68

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_174494.2 Gene:bZIP68 / 840107 AraportID:AT1G32150 Length:389 Species:Arabidopsis thaliana


Alignment Length:314 Identity:74/314 - (23%)
Similarity:110/314 - (35%) Gaps:114/314 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 PYG--PRP-----PTGGKEEKLLLLAPPGKLYP-------------EASVSTAMPEVLSGTPTNS 131
            |||  |.|     |.||......|  |||. ||             |||.:|.......|.|::.
plant    83 PYGTPPHPYVTMYPPGGMYAHPSL--PPGS-YPYSPYAMPSPNGMAEASGNTGSVIEGDGKPSDG 144

  Fly   132 HNKANIAMMNNVRLSNISPTLSM-NGSSNEASNLHPLSMYG---------------GSISPQSND 180
            ..|..|.     |......:|:| .|.:|||......|..|               ||.:...||
plant   145 KEKLPIK-----RSKGSLGSLNMIIGKNNEAGKNSGASANGACSKSAESGSDGSSDGSDANSQND 204

  Fly   181 SG----------MSDSLGKY-------------------------VPG------------SGYGD 198
            ||          .|:|.|..                         |||            ||:|:
plant   205 SGSRHNGKDGETASESGGSAHGPPRNGSNLPVNQTVAIMPVSATGVPGPPTNLNIGMDYWSGHGN 269

  Fly   199 GMMAQSPSQGGNGPQS---ALTAAQKELFSQRKQREFTPDNKKDESYWDRRRRNNEAAKRSREKR 260
             :....|....:|.||   ...:.::|:..||                 |::.|.|:|:|||.::
plant   270 -VSGAVPGVVVDGSQSQPWLQVSDEREIKRQR-----------------RKQSNRESARRSRLRK 316

  Fly   261 RYNDMVLEQRVIELTKENHVLKAQLDAIRDKF-NISGENLVSVEKILASLPTSE 313
            :.....|.||...|..||..|:|:::.::.:: .:..|| .|::...:|.|:.|
plant   317 QAECDELAQRAEVLNGENSSLRAEINKLKSQYEELLAEN-SSLKNKFSSAPSLE 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 15/59 (25%)
coiled coil 239..297 CDD:269842 15/58 (26%)
bZIP68NP_174494.2 MFMR 1..107 CDD:285072 9/25 (36%)
MFMR_assoc 115..266 CDD:293204 29/155 (19%)
bZIP_plant_GBF1 298..348 CDD:269850 17/66 (26%)
coiled coil 298..348 CDD:269850 17/66 (26%)
BAR <340..>385 CDD:299863 6/31 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.