DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and bZIP16

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_850248.2 Gene:bZIP16 / 818118 AraportID:AT2G35530 Length:409 Species:Arabidopsis thaliana


Alignment Length:403 Identity:76/403 - (18%)
Similarity:130/403 - (32%) Gaps:152/403 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KQDNPSNNKFPRIQAQSNNSHLQHQQ-----------------QLQQKLAQLHHYSQQKLSGSDF 86
            :.:..|..|.|:....|:.:....|:                 |....:...|.|.........:
plant     5 EMEKSSKEKEPKTPPPSSTAPPSSQEPSSAVSAGMATPDWSGFQAYSPMPPPHGYVASSPQPHPY 69

  Fly    87 PYGPR---PPTGGKEEKLLLLAPPGKLYPEASVST--------AMPE-----VLSGTPTN----- 130
            .:|.:   ||.|......:.:.|||.:|...|:..        |||.     .:||..|.     
plant    70 MWGVQHMMPPYGTPPHPYVAMYPPGGMYAHPSMPPGSYPYSPYAMPSPNGMTEVSGNTTGGTDGD 134

  Fly   131 ------------SHNKANIAMMNNVRLSNISPTLSMNGSSNEASNLHPLSMYGGSISPQSNDSGM 183
                        ..::.::..:|.:...|..|..:...|:|.|.:....|...|| |..|:.:..
plant   135 AKQSEVKEKLPIKRSRGSLGSLNMITGKNNEPGKNSGASANGAYSKSGESASDGS-SEGSDGNSQ 198

  Fly   184 SDSLGKYVPGSGYGDGMMAQSPSQGG---NGPQSA-----------------LTAA--------- 219
            :||      |||. ||..|::.|:.|   ||||:.                 :|||         
plant   199 NDS------GSGL-DGKDAEAASENGGSANGPQNGSAGTPILPVSQTVPIMPMTAAGVPGPPTNL 256

  Fly   220 ----------------------------------------------QKELFSQRKQREFTPDNKK 238
                                                          .:||..||           
plant   257 NIGMDYWGAPTSAGIPGMHGKVSTPVPGVVAPGSRDGGHSQPWLQDDRELKRQR----------- 310

  Fly   239 DESYWDRRRRNNEAAKRSREKRRYNDMVLEQRVIELTKENHVLKAQLDAIRDKF-NISGENLVSV 302
                  |::.|.|:|:|||.:::.....|.||...|.:||..|:|:::.::.:. .::.|| .|:
plant   311 ------RKQSNRESARRSRLRKQAECDELAQRAEVLNEENTNLRAEINKLKSQCEELTTEN-TSL 368

  Fly   303 EKILASLPTSEQV 315
            :..|:..|..|.:
plant   369 KDQLSLFPPLEGI 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 15/59 (25%)
coiled coil 239..297 CDD:269842 15/58 (26%)
bZIP16NP_850248.2 MFMR 1..103 CDD:400228 17/97 (18%)
MFMR_assoc 142..272 CDD:406895 28/137 (20%)
BRLZ 304..367 CDD:197664 21/80 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.