DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and nfil3-3

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001122279.1 Gene:nfil3-3 / 799271 ZFINID:ZDB-GENE-081022-142 Length:296 Species:Danio rerio


Alignment Length:168 Identity:50/168 - (29%)
Similarity:83/168 - (49%) Gaps:25/168 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 ELFSQRKQREFTPDNKKDESYWDRRRRNNEAAKRSREKRRYNDMVLEQRVIELTKENHVLKAQLD 286
            |:.:..::||..|..||:|.|.|:|::|||||:|.|||||.||.|:..:|:.|.::|..|||:|.
Zfish    59 EMDASSRKRESIPLEKKEEGYQDKRKKNNEAARRFREKRRNNDRVIGNQVLALLEDNARLKAELL 123

  Fly   287 AIRDKFNI---SGENLVSVEKILASLPTSEQVLSNTKRAKMSGSGGSSSGSS---PSGSGSGEGS 345
            |::.:|.:   ..|:.|.:...:...||    :.:|....:.....|:....   |:||..|   
Zfish   124 ALKLRFGLIKDPSEDPVQIFSHIQEFPT----IRDTNPLTVQPLPISTQNYGFIMPAGSSIG--- 181

  Fly   346 PQGGHNGYPVGPPLSPL--IYGPNGNARPEATVKSVHH 381
                      .|.:|..  :.|...:...|.::||:.|
Zfish   182 ----------NPDISVADEVVGTYSSGYQENSLKSLPH 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 28/61 (46%)
coiled coil 239..297 CDD:269842 27/60 (45%)
nfil3-3NP_001122279.1 bZIP 75..134 CDD:304365 28/58 (48%)
coiled coil 79..130 CDD:269834 25/50 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578032
Domainoid 1 1.000 74 1.000 Domainoid score I9070
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4649
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1450431at2759
OrthoFinder 1 1.000 - - FOG0002055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15284
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.090

Return to query results.
Submit another query.