DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and hlfa

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001070802.1 Gene:hlfa / 768192 ZFINID:ZDB-GENE-061013-159 Length:294 Species:Danio rerio


Alignment Length:205 Identity:63/205 - (30%)
Similarity:91/205 - (44%) Gaps:32/205 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 EEKLLLLAPPGKLYPEASVSTAMP-EVLSGTPTNS----HNKANIAMMNNVRLSNI--SPTL-SM 154
            ||.||....|.....|.|..:..| :..|..||.|    .|:.|.:..|.:...|.  :||. .:
Zfish    89 EEFLLENNIPANPQSEQSQPSQPPLQPPSAPPTPSVVDLSNRDNSSSHNGMVAQNCLQNPTRPGL 153

  Fly   155 NGSSNEASNLHPLSMYGG-SISPQSNDSGMSDSLGKYVPGSGYGDGMMAQSPSQGGNGPQSALTA 218
            ..|.:..|.:.|.|:... :..|...|..:|.     |||....|             |:....:
Zfish   154 PASRDTPSPIDPDSIQVPLAYEPDPADLALSS-----VPGQEIFD-------------PRKRKFS 200

  Fly   219 AQKELFSQ---RKQRE-FTPDNKKDESYWDRRRRNNEAAKRSREKRRYNDMVLEQRVIELTKENH 279
            |: ||..|   :|.|: |.|::.||:.||.|||:||.||||||:.||..:..:..|...|.|||.
Zfish   201 AE-ELKPQPMIKKARKVFIPEDLKDDRYWARRRKNNIAAKRSRDARRLKENQIAIRAGFLEKENA 264

  Fly   280 VLKAQLDAIR 289
            .|:|::..:|
Zfish   265 ALRAEVADLR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 25/52 (48%)
coiled coil 239..297 CDD:269842 24/51 (47%)
hlfaNP_001070802.1 bZIP_HLF 223..282 CDD:269843 25/52 (48%)
coiled coil 224..282 CDD:269843 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.