DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and junb

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001037955.1 Gene:junb / 733713 XenbaseID:XB-GENE-945864 Length:307 Species:Xenopus tropicalis


Alignment Length:276 Identity:54/276 - (19%)
Similarity:93/276 - (33%) Gaps:87/276 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 HHYSQQKLSGSDFP-YGPR--PPTGGKE---EKLLLLAPPGKLYPEASVSTAMPEVLSGTPTNSH 132
            |.....:|:..|.| |.|:  ||.....   ..|.:.||.    .|..:..:.|.|:|| |:...
 Frog    33 HLTEPYRLAKHDLPYYAPQDSPPLASHHPAPSSLKMAAPE----LERMIIHSGPGVISG-PSGGQ 92

  Fly   133 ----NKAN-------------IAMMNNVRLSN--ISPTLSMNGSSNEASNLHPLSMYGGSISPQS 178
                ::.|             :..::::...|  .||.:|:.|.|        :.:.|.:.||..
 Frog    93 LYYSSRGNGITEEQEGFVDGFVKALDDLHKMNRECSPNVSLGGGS--------IPLGGSAASPAG 149

  Fly   179 N----DSGMSDSLGKYVPGS----------------GYGDGMMAQSPS-------------QGGN 210
            :    |:.:..:|..|.|..                |:|.....:.|.             :|..
 Frog   150 SNIYGDAAVYTNLANYHPSCYRQPSATINYLPQTHIGFGASPFKEEPQTVPDTAGVRVDSREGSP 214

  Fly   211 GPQSALTAAQKELFSQRKQREFTPDNKKDESYWDRRRRNNEAAKRSREKRRYNDMVLEQRVIELT 275
            .|.|.:....:|.....:                :|.||..||.:.|:::......||.:|.||.
 Frog   215 TPLSPINMEDQERIKVER----------------KRLRNRLAATKCRKRKLERIARLEDKVRELK 263

  Fly   276 KENHVLKAQLDAIRDK 291
            .||..|.....|:|::
 Frog   264 NENSGLSGTAGALREQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 16/54 (30%)
coiled coil 239..297 CDD:269842 16/53 (30%)
junbNP_001037955.1 Jun 5..201 CDD:281890 34/180 (19%)
bZIP_Jun 229..289 CDD:269844 16/67 (24%)
coiled coil 230..281 CDD:269844 16/66 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.