DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and Hlf

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:XP_006247198.1 Gene:Hlf / 690286 RGDID:1582828 Length:296 Species:Rattus norvegicus


Alignment Length:213 Identity:59/213 - (27%)
Similarity:92/213 - (43%) Gaps:46/213 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PPGKLYPEASVSTAMPEVLS--------GTPTNSHNKANIAMMNNVRLSNISPTLSMNGSSNEAS 162
            ||| |.|.:|.:.::.::.|        |.|:.:      .|.|.:|...:.|     .:.|..|
  Rat   110 PPG-LQPASSTAPSVMDLSSRATAPLHPGIPSPN------CMQNPIRPGQLLP-----ANRNTPS 162

  Fly   163 NLHP--LSMYGGSISPQSNDSGMSDSLGKYVPGSGYGDGMMAQSPSQGGNGPQSALTAAQKELFS 225
            .:.|  :.:..| ..|...|..:|.     :||....|....:. |:....||..:..|:|    
  Rat   163 PIDPDTIQVPVG-YEPDPADLALSS-----IPGQEMFDPRKRKF-SEEELKPQPMIKKARK---- 216

  Fly   226 QRKQREFTPDN-KKDESYWDRRRRNNEAAKRSREKRRYNDMVLEQRVIELTKENHVLKAQLDAIR 289
                 .|.||: |:|:.||.|||:||.||||||:.||..:..:..|...|.|||..|:.::..:|
  Rat   217 -----VFIPDDLKQDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLR 276

  Fly   290 DKFNISGENLVSVEKILA 307
                   :.|...:.|||
  Rat   277 -------KELGKCKNILA 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 23/58 (40%)
coiled coil 239..297 CDD:269842 23/57 (40%)
HlfXP_006247198.1 bZIP_HLF 226..284 CDD:269843 24/64 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.