DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and Batf3

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_068637.2 Gene:Batf3 / 60462 RGDID:620501 Length:118 Species:Rattus norvegicus


Alignment Length:114 Identity:30/114 - (26%)
Similarity:49/114 - (42%) Gaps:24/114 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 PGSGYGDGMMAQSPSQGGNGPQSALTAAQKELFSQRKQREFTPDNKKDESYWDRRRRNNEAAKRS 256
            |.:|   |::..|.:..||.|||.                     |.|:....||.:|..||:||
  Rat     5 PPAG---GVLQSSVAAPGNQPQSP---------------------KDDDRKVRRREKNRVAAQRS 45

  Fly   257 REKRRYNDMVLEQRVIELTKENHVLKAQLDAIRDKFNISGENLVSVEKI 305
            |:|:......|.:....|.:||.||:.::..::::.....|.|...||:
  Rat    46 RKKQTQKADKLHEEHESLEQENSVLRREIAKLKEELRHLSEALKEHEKM 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 16/58 (28%)
coiled coil 239..297 CDD:269842 16/57 (28%)
Batf3NP_068637.2 bZIP 28..85 CDD:419672 16/56 (29%)
coiled coil 30..84 CDD:269834 15/53 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.