Sequence 1: | NP_001137792.1 | Gene: | vri / 33759 | FlyBaseID: | FBgn0016076 | Length: | 729 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001183989.1 | Gene: | dbpa / 565056 | ZFINID: | ZDB-GENE-060503-802 | Length: | 366 | Species: | Danio rerio |
Alignment Length: | 227 | Identity: | 58/227 - (25%) |
---|---|---|---|
Similarity: | 81/227 - (35%) | Gaps: | 81/227 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 PEASVSTAMPEVLSGTPTNSHNKANIAMMNNVRLSNISPTLSMNGSSNEASNLHPLSMYGGSISP 176
Fly 177 QSNDSGMSDSLGKYVP-GSG--------YGDGMMAQSPSQGGNGP-------------------- 212
Fly 213 --QSALTAAQ-KELFSQRKQR-----------------EFTPDNKKDESYWDRRRRNNEAAKRSR 257
Fly 258 EKRRYNDMVLEQRVIELTKENHVLKAQLDAIR 289 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
vri | NP_001137792.1 | bZIP_NFIL3 | 238..297 | CDD:269842 | 22/52 (42%) |
coiled coil | 239..297 | CDD:269842 | 21/51 (41%) | ||
dbpa | NP_001183989.1 | bZIP_HLF | 295..354 | CDD:269843 | 22/52 (42%) |
coiled coil | 296..354 | CDD:269843 | 21/51 (41%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3119 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |