DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and dbpa

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001183989.1 Gene:dbpa / 565056 ZFINID:ZDB-GENE-060503-802 Length:366 Species:Danio rerio


Alignment Length:227 Identity:58/227 - (25%)
Similarity:81/227 - (35%) Gaps:81/227 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 PEASVSTAMPEVLSGTPTNSHNKANIAMMNNVRLSNISPTLSMNGSSNEASNLHPLSMYGGSISP 176
            |..|..:|:|...|..|.:|                 ||               |.|....|||.
Zfish   152 PSQSTQSAVPSQSSQCPPSS-----------------SP---------------PCSSSASSISS 184

  Fly   177 QSNDSGMSDSLGKYVP-GSG--------YGDGMMAQSPSQGGNGP-------------------- 212
            .|:.|..|..||..|| |.|        :|...:...|||..:.|                    
Zfish   185 LSSSSSSSSLLGLDVPQGPGLLGGPECLHGAQTVPPDPSQSPSCPPPPVVPPTNAADVMVNFDPD 249

  Fly   213 --QSALTAAQ-KELFSQRKQR-----------------EFTPDNKKDESYWDRRRRNNEAAKRSR 257
              ..||::.. :|.|..|:.|                 ...||.:||:.||.||.:|:|||||||
Zfish   250 PADLALSSVPGQEAFDPRRHRFSEEELKPQPMIKKARKMLVPDEQKDDKYWCRRLKNDEAAKRSR 314

  Fly   258 EKRRYNDMVLEQRVIELTKENHVLKAQLDAIR 289
            :.||..:..:..|...|.:||..|:.::..:|
Zfish   315 DARRLKENQISVRAAFLERENAALRQEVADMR 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 22/52 (42%)
coiled coil 239..297 CDD:269842 21/51 (41%)
dbpaNP_001183989.1 bZIP_HLF 295..354 CDD:269843 22/52 (42%)
coiled coil 296..354 CDD:269843 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.