DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and ddit3

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:XP_005166228.1 Gene:ddit3 / 561924 ZFINID:ZDB-GENE-070410-90 Length:242 Species:Danio rerio


Alignment Length:258 Identity:61/258 - (23%)
Similarity:98/258 - (37%) Gaps:62/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   504 PPSAGLYVPAPSAYKDHLEAAAAWSHNVEAAVSSSAVDAVSSSSVSGSAASVLNLSRRACS---- 564
            ||..|   |...|   .||   ||..:::              .:.||......|:|...|    
Zfish     8 PPGVG---PLCGA---ELE---AWYEDLQ--------------DILGSDTGGAKLTRAPPSSEKE 49

  Fly   565 PSYEHMLSSTTSSTLSSASSSGAVSGDDEQ---EHEPAHMAPLQLQRSSPQQGSDANNCLP---L 623
            |.:..:|.|.:.:.|    :.|.|.||..|   |..|.|.:|.: |.....:.:.:.:.||   .
Zfish    50 PEFLDVLESCSLTWL----TEGQVWGDGVQRVTEDPPVHQSPPR-QEERTTENTSSGDLLPPEFF 109

  Fly   624 KLRHKSHLGD--------------KDAAATALLSLQHIKQEPNCSRA--------SPPAWNDGGD 666
            :|..:..:||              ...||:....|..:....:||.|        ||||  ....
Zfish   110 ELLSEGGVGDTMVNGGAGYHLHAPPSPAASEEEELPTVPDTSSCSSASRSPSLNCSPPA--SPPV 172

  Fly   667 NSSDERDSGISIASAEWTAQLQRKLLAPKEANVVTSAERDQMLKSQLERLESEVASIKMILAE 729
            :||.:|..|.::.||....:.:|:.....|..|....::::.||:::|||..||...:..|.|
Zfish   173 SSSRKRKRGGALCSASPGKKSRREREQENERKVQELTDQNERLKAEIERLGEEVQRTRRALIE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842
coiled coil 239..297 CDD:269842
ddit3XP_005166228.1 bZIP <204..235 CDD:304365 9/30 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.