DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and tef

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001017319.1 Gene:tef / 550073 XenbaseID:XB-GENE-962732 Length:296 Species:Xenopus tropicalis


Alignment Length:281 Identity:72/281 - (25%)
Similarity:103/281 - (36%) Gaps:75/281 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 PYGPRPPTGGKEEKLL--LLAPPGKLYPE----------------------ASVSTAMP------ 121
            |..|.|..||....:|  ||..|.|.:.|                      ||.|...|      
 Frog    10 PVTPSPLLGGSFPIVLRKLLENPPKDFLETRDEKDKSKLDKDDDHDCNSLVASASLMPPIWDKTI 74

  Fly   122 ---------------EVL--SGTPTNSHNKANIAMMNNVRLSNISPTLSMNGSSNEASNLHPLSM 169
                           |.|  :|.|::....|.......|.:|.:... |...|::.||.|.|   
 Frog    75 PYDGESFHLEYMDLDEFLLENGIPSSPTQLAQALQNPLVPVSELESD-SEPASTSAASPLSP--- 135

  Fly   170 YGGSISPQSNDSGMSDSLGKYVPGSGYGDGMMAQSPSQGGNGPQSAL--TAAQKELFSQRKQR-- 230
               |:..|.::...|||..:..|.|.. |....:........|...|  |...:|||..||.|  
 Frog   136 ---SVLLQKSEVKDSDSKAEEDPPSPI-DPEKVEIQVNFNPDPSDLLLSTVPGEELFDPRKHRFA 196

  Fly   231 ---------------EFTPDNKKDESYWDRRRRNNEAAKRSREKRRYNDMVLEQRVIELTKENHV 280
                           .:.|::.|||.||.||.:||.||||||:.||..:..:..|...|.|||..
 Frog   197 EEELKPQPMIKKAKKIYVPEDLKDEKYWTRRNKNNVAAKRSRDARRLKENQITVRAAFLEKENSA 261

  Fly   281 LKAQLDAIRDKFNISGENLVS 301
            |::::..:|.:.: ...|::|
 Frog   262 LRSEVADLRKELS-KCRNIIS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 24/58 (41%)
coiled coil 239..297 CDD:269842 23/57 (40%)
tefNP_001017319.1 T4BSS_DotH_IcmK 132..>184 CDD:289093 13/58 (22%)
bZIP_HLF 219..278 CDD:269843 24/59 (41%)
coiled coil 220..278 CDD:269843 23/58 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.