DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and ccdc127

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001016568.1 Gene:ccdc127 / 549322 XenbaseID:XB-GENE-956958 Length:266 Species:Xenopus tropicalis


Alignment Length:177 Identity:39/177 - (22%)
Similarity:66/177 - (37%) Gaps:56/177 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 NLHPLSMYGGSISPQSNDSGMSDSLGKY---VPGSGYGDGMMAQSPSQGGNGPQSALTAAQKELF 224
            |:||            |:.|...|...|   ||..|                     .||.:.::
 Frog    11 NIHP------------NEDGREGSKWNYALLVPMLG---------------------LAAFRWIW 42

  Fly   225 SQRKQREFTPDNKKDESYWDRRRRNNEAAKRSREKRRYNDMVLEQR------VIELTKENHVLKA 283
            |:..::|.: :.|.:.|      :..|:|::..| .:|.|.:.|.|      .|||.||.:...:
 Frog    43 SKESEKEIS-ETKSECS------KKLESAQKDLE-AKYRDTITESRRTIAHLEIELEKEKNRTLS 99

  Fly   284 QLDAIRDKFNISGENLVSVEKILASLPTSEQVLSNTKRAKMSGSGGS 330
            ...||..:    |:.||...|.|..  ..|::....:..:.||:.|:
 Frog   100 YRRAIISQ----GQKLVEERKQLEQ--EREELFLEKQAVQKSGAAGT 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 15/64 (23%)
coiled coil 239..297 CDD:269842 15/63 (24%)
ccdc127NP_001016568.1 PRK12704 27..>165 CDD:237177 32/149 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165164360
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.