DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and cebpa

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001011044.1 Gene:cebpa / 496454 XenbaseID:XB-GENE-853397 Length:297 Species:Xenopus tropicalis


Alignment Length:118 Identity:33/118 - (27%)
Similarity:58/118 - (49%) Gaps:13/118 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 QSPSQGGNGPQSALTAAQKELFSQRKQREFTPDNKKDESYWDRRRRNNEAAKRSREKRRYNDMVL 267
            ||.|.....|.|:::::..|  ::.|.:::.  :|....|..||.|||.|.::||:|.:..:...
 Frog   189 QSSSLKSVSPSSSISSSSSE--NRGKSKKWV--DKSSSEYRVRRERNNIAVRKSRDKAKMRNAET 249

  Fly   268 EQRVIELTKENHVLKAQLDAIRDKFNISGENLVSVEKILASLPTSE--QVLSN 318
            :.:||||:.||       |.:|.:.......|.::..|...||.|.  :|:.|
 Frog   250 QHKVIELSTEN-------DKLRKRVEQLSRELETLRGIFRQLPESSLVKVMGN 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 18/58 (31%)
coiled coil 239..297 CDD:269842 18/57 (32%)
cebpaNP_001011044.1 bZIP_CEBPB 214..284 CDD:269860 21/78 (27%)
coiled coil 221..282 CDD:269860 20/67 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.