DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and ATF4

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001666.2 Gene:ATF4 / 468 HGNCID:786 Length:351 Species:Homo sapiens


Alignment Length:235 Identity:56/235 - (23%)
Similarity:81/235 - (34%) Gaps:48/235 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 PYGPRPPTGGKEEKLLLLAPPGKLYPEASVSTAMPEVLSGTPTNSHNKANIAMMNNVRLSNISPT 151
            |.|..|.:..|.::   :||...|.|    ....|.|||.||.:|                .|..
Human   140 PIGHLPESLTKPDQ---VAPFTFLQP----LPLSPGVLSSTPDHS----------------FSLE 181

  Fly   152 LSMNGSSNEASNLHPLSMYGGSI--------SPQSNDSGMSDSLGKYVPGSGYGDGMMAQSPSQG 208
            |.......|.......:.|...|        :|..||||:..|...|:       |....|||..
Human   182 LGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYL-------GSPQHSPSTR 239

  Fly   209 GNGPQSALTAAQKELFSQRKQREFTPDNK---------KDESYWDRRRRNNEAAKRSREKRRYND 264
            |: |..:|.:......|.|.:....|..|         |.:....:..:|..||.|.|:|:|...
Human   240 GS-PNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQ 303

  Fly   265 MVLEQRVIELTKENHVLKAQLDAIRDKFNISGENLVSVEK 304
            ..|.....||.|:|..||.:.|::..:.....:.:..|.|
Human   304 EALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 16/58 (28%)
coiled coil 239..297 CDD:269842 15/57 (26%)
ATF4NP_001666.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..268 17/65 (26%)
BetaTrCP degron motif. /evidence=ECO:0000269|PubMed:11238952 215..224 4/8 (50%)
bZIP_ATF4 279..341 CDD:269840 15/61 (25%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 280..300 6/19 (32%)
coiled coil 281..340 CDD:269840 15/58 (26%)
Interaction with GABBR1. /evidence=ECO:0000250 305..341 8/35 (23%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 306..334 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.