DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and Pdp1

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster


Alignment Length:333 Identity:83/333 - (24%)
Similarity:126/333 - (37%) Gaps:96/333 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KNNTDTNYINNYKQDNPSNNKFPRIQAQSN--------NSHLQHQQQLQQKLAQLHHYSQQKLSG 83
            :||.:.|..|:...:|.|||....:|..:|        |.|..|...|:.:.       |...||
  Fly   341 QNNNNNNGNNSGNSNNNSNNNVSSVQHVANAVAAAVIANEHHNHLNSLKARF-------QPASSG 398

  Fly    84 SDFPY-------GPRPPTGGKEEKLLLLAPPGKLYPEASV-----STAM--PEVLSGT-PTNSHN 133
            ...|:       ..:..:..||    ::.|..|...|..:     .||.  |.:...| |.::..
  Fly   399 RKSPFLGFICKSNGKSTSNSKE----IICPDDKYKEEGDIWNVEAQTAFLGPNLWDKTLPYDADL 459

  Fly   134 KANIAMMNNVRLSNISPTLSMNGSSNEASNLHPLSMYGGSISPQSNDSGMSDSLGKYVPGSGYGD 198
            |.       .:.:::...||.|       |: |..:.|..:...|.....||||| :..|...|.
  Fly   460 KV-------TQYADLDEFLSEN-------NI-PDGLPGTHLGHSSGLGHRSDSLG-HAAGLSLGL 508

  Fly   199 GMMA----QSPSQGG-------NGPQSALTA-----------------AQKELFSQ----RKQRE 231
            |.:.    :|||...       |.|..|.:.                 :.:||..|    :.:::
  Fly   509 GHITTKRERSPSPSDCISPDTLNPPSPAESTFSFASSGRDFDPRTRAFSDEELKPQPMIKKSRKQ 573

  Fly   232 FTPDNKKDESYWDRRRRNNEAAKRSREKRRYND--------------MVLEQRVIELTKENHVLK 282
            |.||..||:.||.|||:||.||||||:.||..:              ..|.|.|.:|.:||..|:
  Fly   574 FVPDELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLR 638

  Fly   283 AQLDAIRD 290
            |:|...:|
  Fly   639 ARLSKFQD 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 27/67 (40%)
coiled coil 239..297 CDD:269842 26/66 (39%)
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 24/58 (41%)
coiled coil 581..639 CDD:269843 23/57 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.