DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and atf4

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001004785.1 Gene:atf4 / 448005 XenbaseID:XB-GENE-983841 Length:336 Species:Xenopus tropicalis


Alignment Length:234 Identity:50/234 - (21%)
Similarity:92/234 - (39%) Gaps:63/234 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 ASVSTAMPEVLSGTPTNSH-----NKANIAMMNNVRLSNISPTLSMNGSSNEASNLHPLSMYGGS 173
            |..|..:...||.:|.:|.     ::.::|  .:.:.|:.:.||.:.....|.|:          
 Frog   144 APFSPDLTASLSSSPDHSFILDVGSEVDVA--EDEKKSSATYTLEILKCEKEDSS---------- 196

  Fly   174 ISPQSNDSGMSDSLGKYVPGSGYGDGMMAQSPS--QGGNGPQSALTA-------------AQKEL 223
                .||||:|.| ..|:...       .||||  :..:.|||:|.:             ..:::
 Frog   197 ----DNDSGISMS-PSYLESP-------QQSPSTVECYSSPQSSLESPVSERPKPYDLPCKDRDV 249

  Fly   224 FSQRKQREFTP--DNKKDESYWDRRRRNNEAAKRSREKRRYNDMVLEQRVIELTKENHVLKAQLD 286
            .::.|.....|  |.||     .:..:|..||.|.|:|:|....::.....||..:|..|:.::|
 Frog   250 MAKVKVAGGQPRVDKKK-----KKMEQNKTAATRYRQKKRAEQELISGECRELEGKNDTLREKVD 309

  Fly   287 AIRDKFNISGENLVSVEKILASLPTSEQVLSNTKRAKMS 325
            ::..:.....:.:..|.:            :.:||||.|
 Frog   310 SLTKEIQYLKDLIAEVRQ------------AKSKRAKSS 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 13/58 (22%)
coiled coil 239..297 CDD:269842 12/57 (21%)
atf4NP_001004785.1 bZIP_ATF4 269..325 CDD:269840 12/55 (22%)
coiled coil 269..324 CDD:269840 12/54 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.