DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and Irbp18

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster


Alignment Length:107 Identity:32/107 - (29%)
Similarity:55/107 - (51%) Gaps:16/107 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 PQSALTAAQKELFSQRKQREFTPDNKKDESYWDRRRRNNEAAKRSREKRRYNDMVLEQRVIELTK 276
            |....|||..   |:......:| :..|.:|.::|::||||.:|:|||.:.:....::|:.:|.|
  Fly     2 PAKKRTAAST---SKNSDSPLSP-HTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRK 62

  Fly   277 ENHVLKAQLD-------AIRDKFNISGENLVS----VEKILA 307
            :|..||.|::       .:||.. |.||....    :::|||
  Fly    63 QNDALKVQIETSEKHISTLRDLI-IQGEKTEDGHRIIQEILA 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 21/65 (32%)
coiled coil 239..297 CDD:269842 21/64 (33%)
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 18/58 (31%)
coiled coil 25..83 CDD:269841 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.