DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and Batf3

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_084336.1 Gene:Batf3 / 381319 MGIID:1925491 Length:118 Species:Mus musculus


Alignment Length:106 Identity:29/106 - (27%)
Similarity:51/106 - (48%) Gaps:13/106 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 MAQSPSQGGNGPQSALTAAQKELFSQRKQREFTPDNKKDESYWDRRR-RNNEAAKRSREKRRYND 264
            |:|.|        .|::..|:.:.:...|    |.:.||:....||| :|..||:|||:|:....
Mouse     1 MSQGP--------PAVSVLQRSVDAPGNQ----PQSPKDDDRKVRRREKNRVAAQRSRKKQTQKA 53

  Fly   265 MVLEQRVIELTKENHVLKAQLDAIRDKFNISGENLVSVEKI 305
            ..|.:....|.:||.||:.::..::::.....|.|...||:
Mouse    54 DKLHEEHESLEQENSVLRREISKLKEELRHLSEVLKEHEKM 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 18/59 (31%)
coiled coil 239..297 CDD:269842 17/58 (29%)
Batf3NP_084336.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 23/79 (29%)
bZIP 28..85 CDD:304365 16/56 (29%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 30..55 10/24 (42%)
coiled coil 31..82 CDD:269834 16/50 (32%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 56..84 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.