DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and Batf

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001100218.1 Gene:Batf / 299206 RGDID:1304923 Length:125 Species:Rattus norvegicus


Alignment Length:147 Identity:31/147 - (21%)
Similarity:54/147 - (36%) Gaps:47/147 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 PQSNDSGMSDSLGKYVPGSGYGDGMMAQSPSQGGNGPQSALTAAQKELFSQRKQREFTPDNKKDE 240
            |.|:||               .|...::||..|                   ||     |:..|.
  Rat     2 PHSSDS---------------SDSSFSRSPPPG-------------------KQ-----DSSDDV 27

  Fly   241 SYWDRRRRNNEAAKRSREKRRYNDMVLEQRVIELTKENHVLKAQLDAIRDKFNI------SGENL 299
            ....||.:|..||::||:::......|.....:|.|:|..|:.::..:.::...      |.|.|
  Rat    28 RKVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLSSHEPL 92

  Fly   300 VSVEKILASLPTSEQVL 316
            .||  :.:..|:..:|:
  Rat    93 CSV--LASGTPSPPEVV 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 14/64 (22%)
coiled coil 239..297 CDD:269842 14/63 (22%)
BatfNP_001100218.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59 20/95 (21%)
bZIP_BATF 26..83 CDD:269849 13/56 (23%)
Basic motif 28..50 7/21 (33%)
coiled coil 29..80 CDD:269849 12/50 (24%)
Leucine-zipper 54..75 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.