DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and Cebpd

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_037286.1 Gene:Cebpd / 25695 RGDID:2328 Length:268 Species:Rattus norvegicus


Alignment Length:264 Identity:61/264 - (23%)
Similarity:102/264 - (38%) Gaps:84/264 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GPRPPTGGKEEKLLLLAPPGKLYP-----EASVS-TAMPEVLSGTPT-------------NSHNK 134
            ||.|..         |..||...|     |:::. :|..:.::..||             ||::|
  Rat    36 GPEPGD---------LGEPGSTTPAMYDDESAIDFSAYIDSMAAVPTLELCHDEIFADLFNSNHK 91

  Fly   135 ANIAMMNNVRLSNISPTLSMNGSSNEASNLHPLSMYGGSIS----PQSNDSGMSDSLGKYVPGSG 195
            |  |...::.|....||             .|..:  |||:    .:..|.|..|:.|..:|.. 
  Rat    92 A--AGAGSLELLQGGPT-------------RPPGV--GSIARGPLKREPDWGDGDAPGSLLPAQ- 138

  Fly   196 YGDGMMAQS-----------------PSQGGNGPQSALTAAQKELFSQRKQREFTPDNKKDESYW 243
              ..:.||:                 |.:|..||..|....:::...:|     .||....| |.
  Rat   139 --VAVCAQTVVSLAAAAQPTPPTSPEPPRGSPGPSLAPGPVREKGAGKR-----GPDRGSPE-YR 195

  Fly   244 DRRRRNNEAAKRSREKRRYNDMVLEQRVIELTKENHVLKAQLDAI-RDKFNISGENLVSVEKILA 307
            .||.|||.|.::||:|.:..:..::|:::||:.||..|..:::.: ||        |.|:.:...
  Rat   196 QRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRD--------LASLRQFFK 252

  Fly   308 SLPT 311
            .||:
  Rat   253 ELPS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 19/59 (32%)
coiled coil 239..297 CDD:269842 19/58 (33%)
CebpdNP_037286.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 6/22 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..132 10/48 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..223 20/76 (26%)
bZIP_CEBPD 188..252 CDD:269862 22/72 (31%)
coiled coil 191..249 CDD:269862 21/66 (32%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 195..222 9/26 (35%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 226..254 8/35 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.