DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and Jun

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_068607.1 Gene:Jun / 24516 RGDID:2943 Length:334 Species:Rattus norvegicus


Alignment Length:185 Identity:44/185 - (23%)
Similarity:62/185 - (33%) Gaps:43/185 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 KILASLPTSEQVLSNTKRAKMSGSGGSSSGSSPSGSGSGEGSPQGGHNGYPVGPPLSPLIYGPNG 368
            :.||.|.:...:.|.|..|:.....|..:.:..|.:|:      ||..||.......|.:|....
  Rat   116 RALAELHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGA------GGGGGYSASLHSEPPVYANLS 174

  Fly   369 NARPEATVKSVHHIHHAGVAPPPTHLQQLVVPQSQTQHLYQPQPQQHQPHQQQQIS-QPPQQQQQ 432
            |..|.|.        .:|...|......|..|....|....|||..|.|   |||. |.|:.|..
  Rat   175 NFNPGAL--------SSGGGAPSYGATGLAFPSQPQQQQQPPQPPHHLP---QQIPVQHPRLQAL 228

  Fly   433 QQEPSPSAGSSSPVISDPHNRPPSTTIANLQVQLQQALNRNVRPEDLDSLRKVVA 487
            ::||       ..|...|...||                  :.|.|::|..::.|
  Rat   229 KEEP-------QTVPEMPGETPP------------------LSPIDMESQERIKA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842
coiled coil 239..297 CDD:269842
JunNP_068607.1 Jun 5..244 CDD:281890 38/151 (25%)
Interaction with PAGE4. /evidence=ECO:0000250|UniProtKB:P05412 150..226 25/92 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..217 10/35 (29%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 255..282 1/4 (25%)
bZIP_Jun 257..317 CDD:269844 1/2 (50%)
coiled coil 258..309 CDD:269844 1/1 (100%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 283..311
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.