DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and Atf7

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001296995.1 Gene:Atf7 / 223922 MGIID:2443472 Length:483 Species:Mus musculus


Alignment Length:397 Identity:86/397 - (21%)
Similarity:132/397 - (33%) Gaps:119/397 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 YGPRPPTGGKEEKLLLLAPPGKLY---PEASV--------STAMPEVLSGTPTNSHNKANIAMMN 141
            |.|..||......::..|||....   |..|:        ...|| :|.|.|....:..::|...
Mouse   162 YDPLHPTLPSPTSVITQAPPSNRQIGSPTGSLPLVMHLANGQTMP-MLPGPPVQMPSVISLARPV 225

  Fly   142 NVRLSNIS--PTLSMNGSSNEASNLHPLSMYGGSISPQSNDSGMSDSLGKYVPGSGYGDGMM--- 201
            :: :.||.  |...:|.|.:.:.:.||:        |......:..:|...|.....|.||:   
Mouse   226 SM-VPNIPGIPGPPVNNSGSISPSGHPM--------PSEAKMRLKATLTHQVSSINGGCGMVVGT 281

  Fly   202 --------------------AQSPSQGGNGPQSALTAAQKELFSQRKQREFTPDNKKDESYWDRR 246
                                |.||:|    ||  ::.||....:..::|. |.|...||......
Mouse   282 ASTMVTARPEQNQILIQHPDAPSPAQ----PQ--VSPAQPTPSTGGRRRR-TVDEDPDERRQRFL 339

  Fly   247 RRNNEAAKRSREKRRYNDMVLEQRVIELTKENHVLKAQLDAIRDKFNISGENLVSVEKILASLPT 311
            .||..||.|.|:||:.....||::..|||.:|..|..::..:|::              :|.|  
Mouse   340 ERNRAAASRCRQKRKLWVSSLEKKAEELTSQNIQLSNEVTLLRNE--------------VAQL-- 388

  Fly   312 SEQVLSNTKRAKMSGSGGSSSG--SSPSGSGSGEGSPQGGHNGYPVGPPLSPLIYGPNGNARPEA 374
             :|:|...|...::.....:.|  .||..|....|||.      ||                   
Mouse   389 -KQLLLAHKDCPVTALQKKTQGYLESPKESSEPTGSPA------PV------------------- 427

  Fly   375 TVKSVHHIHHAGVAPPPTHLQ-----QLVVPQSQTQHLYQPQPQQHQPHQQQQISQPPQQQQQQQ 434
                   |.|:..:.|...|.     :.|.....||          ...|:.::|.|.|......
Mouse   428 -------IQHSSASAPSNGLSVRSAAEAVATSVLTQ----------MASQRTELSMPIQSHVIMT 475

  Fly   435 EPSPSAG 441
            ..|.|||
Mouse   476 PQSQSAG 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 18/58 (31%)
coiled coil 239..297 CDD:269842 18/57 (32%)
Atf7NP_001296995.1 Transactivation domain. /evidence=ECO:0000250 1..285 28/132 (21%)
C2H2 Zn finger 9..31 CDD:275370
GCN4_cent 47..84 CDD:213399
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..140
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..337 13/44 (30%)
bZIP_ATF2 334..394 CDD:269835 20/76 (26%)
coiled coil 334..394 CDD:269835 20/76 (26%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 334..354 7/19 (37%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 360..388 9/41 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.