DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and Tef

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:XP_011243859.1 Gene:Tef / 21685 MGIID:98663 Length:340 Species:Mus musculus


Alignment Length:246 Identity:64/246 - (26%)
Similarity:91/246 - (36%) Gaps:80/246 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 PRPPTGGKEEKLLLLAP-PGKLYPEASVSTAMP-----------EVLSGTPTNSHNK---ANIAM 139
            |..||...:..||.:|. .||  ..||.|||.|           |.:|.|.::...:   |.::.
Mouse   109 PASPTHLAQNLLLPVAELEGK--ESASSSTASPPSSSTAIFQPSETVSSTASHMEQEDPGARVSQ 171

  Fly   140 MNNV-----------RLSNISPTL--SMNGSSNEASNLHPLSM-YGGSISPQSNDSGMSDSLGKY 190
            ....           :.:.||.||  |:.......|.:.|..: ...:.:|...|..:|.     
Mouse   172 AKTTFSFSYFPVGFWKANCISLTLESSLEKERETPSPIDPSCVEVDVNFNPDPADLVLSS----- 231

  Fly   191 VPGSGYGDGMMAQSPSQGGNGPQSALTAAQKELFSQRKQR-----------------EFTPDNKK 238
            |||.                           |||:.||.|                 .|.||.:|
Mouse   232 VPGG---------------------------ELFNPRKHRFAEEDLKPQPMIKKAKKVFVPDEQK 269

  Fly   239 DESYWDRRRRNNEAAKRSREKRRYNDMVLEQRVIELTKENHVLKAQLDAIR 289
            ||.||.||::||.||||||:.||..:..:..|...|.|||..|:.::..:|
Mouse   270 DEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTALRTEVAELR 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 24/52 (46%)
coiled coil 239..297 CDD:269842 23/51 (45%)
TefXP_011243859.1 bZIP_HLF 269..327 CDD:269843 24/52 (46%)
coiled coil 273..324 CDD:269843 21/48 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.