DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and cebp-1

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_508276.2 Gene:cebp-1 / 180481 WormBaseID:WBGene00016997 Length:319 Species:Caenorhabditis elegans


Alignment Length:346 Identity:72/346 - (20%)
Similarity:129/346 - (37%) Gaps:111/346 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSIVCTLEQK------VNFFKAAATTKNLLILKNNTDTNYINNYKQDNPSNN-KFPRIQAQSNNS 58
            ::|..:|:|:      |:|.:......:.|.:.::.|.          |::| .|...:.|..|.
 Worm    54 LTIAASLQQRDRERHPVDFMETELDLGDYLQVLHDLDV----------PTDNVDFDDAELQKCNI 108

  Fly    59 HLQHQQQLQQKLAQLHHYSQQKLSGSD--FPYGPRPPTGGKEEKLLLLAPPGKLYPEASVSTAMP 121
            ....:          |.|.|.:|:|.:  ..||    ||.:        .||....:......  
 Worm   109 LYDGE----------HPYEQPELNGYERHVAYG----TGYR--------VPGDYDQDGYKMNC-- 149

  Fly   122 EVLSGTPTNSHNKANIAMMNNVRLSNISPTLSMNGSSNEASNLHPLSMYGGSISPQSNDSGMSDS 186
            ||.:.||.....|...|:...|                      |...|....|.:|:|  |:|:
 Worm   150 EVKAETPDFGATKTRRAVKRPV----------------------PYDDYQKEYSEESSD--MTDN 190

  Fly   187 LGKYVPGSGYGDGMMAQSPSQGGNGPQSALT-AAQKELFS-QRKQREF---TPDNKKDESYWDRR 246
                       ||.:..|..:    |:|..| :|..|.|. |.:.|::   ..:.|.:.:|..:|
 Worm   191 -----------DGSVDDSYFE----PKSKKTKSAGLENFKPQTRARKYKLKADEEKAEPTYKLKR 240

  Fly   247 RRNNEAAKRSR-------EKRRYNDMVLEQRVIELTKENHVLKAQLDAIRDKFNISGENLVSVEK 304
            .|||:|.::||       :|:......:::|:.||   ..:|:::.||.|       .:..::|:
 Worm   241 ARNNDAVRKSRKKAKELQDKKEAEHDKMKRRIAEL---EGLLQSERDARR-------RDQDTLEQ 295

  Fly   305 ILASL-PTSEQ------VLSN 318
            :|.:. |..||      :|.|
 Worm   296 LLRNKGPMKEQRMPQRHILEN 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 16/65 (25%)
coiled coil 239..297 CDD:269842 16/64 (25%)
cebp-1NP_508276.2 bZIP 233..280 CDD:304365 12/49 (24%)
coiled coil 236..280 CDD:269834 12/46 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.