DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and zip-7

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_502961.1 Gene:zip-7 / 178459 WormBaseID:WBGene00013100 Length:185 Species:Caenorhabditis elegans


Alignment Length:128 Identity:40/128 - (31%)
Similarity:61/128 - (47%) Gaps:32/128 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 SNLHPLSMYGGSISPQSNDSGMSDSLGKYVPGSGYGDGMMAQSPSQGGNGPQSALTAAQKELFSQ 226
            :|.|..|    |.||.|:.:..:.|               :|:...|.:|             |:
 Worm    58 ANPHATS----SFSPSSSSTSSTTS---------------SQNQQSGSSG-------------SK 90

  Fly   227 RKQREFTPDNKKDESYWDRRRRNNEAAKRSREKRRYNDMVLEQRVIELTKENHVLKAQLDAIR 289
            :|:....|:|:|||:|.||||||||||::|||.|:..|.....||..|.:||..|:..:..::
 Worm    91 KKKPVPVPENQKDEAYLDRRRRNNEAARKSRESRKKVDQDNSVRVTYLERENQCLRVYVQQLQ 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 25/52 (48%)
coiled coil 239..297 CDD:269842 24/51 (47%)
zip-7NP_502961.1 bZIP 102..161 CDD:389750 25/52 (48%)
coiled coil 103..161 CDD:269834 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.