DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and ces-2

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_493610.1 Gene:ces-2 / 173365 WormBaseID:WBGene00000469 Length:211 Species:Caenorhabditis elegans


Alignment Length:91 Identity:27/91 - (29%)
Similarity:49/91 - (53%) Gaps:0/91 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 MAQSPSQGGNGPQSALTAAQKELFSQRKQREFTPDNKKDESYWDRRRRNNEAAKRSREKRRYNDM 265
            :..||....:...|:...:..:....||.....|:.|||.:|::|||:||:||||||:.||..:.
 Worm    78 LCASPVSSRSSTVSSSHFSSPQRSPSRKMSVPIPEEKKDSAYFERRRKNNDAAKRSRDARRQKEE 142

  Fly   266 VLEQRVIELTKENHVLKAQLDAIRDK 291
            .:..:...|.:||..|:.::.::..:
 Worm   143 QIASKAHALERENMQLRGKVSSLEQE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 20/54 (37%)
coiled coil 239..297 CDD:269842 19/53 (36%)
ces-2NP_493610.1 bZIP_HLF 115..173 CDD:269843 20/54 (37%)
coiled coil 116..173 CDD:269843 19/53 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.