Sequence 1: | NP_001137792.1 | Gene: | vri / 33759 | FlyBaseID: | FBgn0016076 | Length: | 729 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001343.2 | Gene: | DBP / 1628 | HGNCID: | 2697 | Length: | 325 | Species: | Homo sapiens |
Alignment Length: | 237 | Identity: | 58/237 - (24%) |
---|---|---|---|
Similarity: | 90/237 - (37%) | Gaps: | 90/237 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 PRPPTGGKEEKLLLLAPPGKLYPEASVSTAMPEVLSGTPTNSHNKANIAMMNNVRLSNISPTLSM 154
Fly 155 NGSSNEASNLHPLSMYGGSISPQSNDSGMSDSLGKYVPGSGYGDGMMAQ-SPSQGGNGPQS---- 214
Fly 215 ----------ALTA--------------AQKELFSQ---RKQREF-TPDNKKDESYWDRRRRNNE 251
Fly 252 AAKRSREKRRYNDMVLEQRVIELTKENHVLKAQLDAIRDKFN 293 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
vri | NP_001137792.1 | bZIP_NFIL3 | 238..297 | CDD:269842 | 26/56 (46%) |
coiled coil | 239..297 | CDD:269842 | 25/55 (45%) | ||
DBP | NP_001343.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..99 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 127..200 | 24/126 (19%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 229..255 | 6/25 (24%) | |||
bZIP_HLF | 254..313 | CDD:269843 | 26/56 (46%) | ||
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 257..279 | 15/21 (71%) | |||
coiled coil | 258..309 | CDD:269843 | 23/50 (46%) | ||
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 283..297 | 5/13 (38%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3119 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |