DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and cebpg

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_571961.1 Gene:cebpg / 140816 ZFINID:ZDB-GENE-020111-5 Length:163 Species:Danio rerio


Alignment Length:208 Identity:55/208 - (26%)
Similarity:76/208 - (36%) Gaps:65/208 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 ISPTLSMNGSS---NEASN--LHPLSMYGGSISPQSNDSGMSDSLGKYVPGSGYGDGMMAQSPSQ 207
            ||.| ..||.|   |:..|  |:|....|....||            .||.:. |.|..|.:|| 
Zfish     9 ISST-DQNGVSVIQNQPHNSALNPAGAAGLQQVPQ------------LVPVNP-GGGGKATAPS- 58

  Fly   208 GGNGPQSALTAAQKELFSQRKQREFTPDNKKDESYWDRRRRNNEAAKRSREKRRYNDMVLEQRVI 272
                                |.::...|...|| |..||.|||.|.|:||.:.:......:|||.
Zfish    59 --------------------KMKKSNMDKDSDE-YRQRRERNNLAVKKSRMRSKQKAQDTQQRVN 102

  Fly   273 ELTKENHVLKA-------QLDAIRDKFNISGENLVSVEKILASLPTSEQVLSNTKRAKMSGSGGS 330
            ||.:||..|:|       :|..::|.|.....|                 |::..:...||.|..
Zfish   103 ELKEENERLEAKIKLLSKELSVLKDLFLEHAHN-----------------LADNVQPPASGGGPG 150

  Fly   331 SSGSSPSGSGSGE 343
            ...::.|||.|.:
Zfish   151 DLCNNNSGSNSSQ 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 24/65 (37%)
coiled coil 239..297 CDD:269842 24/64 (38%)
cebpgNP_571961.1 bZIP_CEBPG 67..127 CDD:269861 22/60 (37%)
coiled coil 69..127 CDD:269861 22/58 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.