DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and cebpa

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_571960.1 Gene:cebpa / 140815 ZFINID:ZDB-GENE-020111-2 Length:288 Species:Danio rerio


Alignment Length:315 Identity:60/315 - (19%)
Similarity:111/315 - (35%) Gaps:92/315 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TTKNLLILKNNTDTNYINNYKQDNPSNNKFPRIQAQSNNSHLQHQQQLQQKLAQLHHYSQQKLSG 83
            |..:|..:..|.::..|:.|...:..|::|        .:.|.|....|:||         ||:.
Zfish    31 TAGDLSEICENENSIDISAYIDPSAFNDEF--------LADLFHNSSKQEKL---------KLAS 78

  Fly    84 SDFPY------GPRPP------TGGKEEKLL--LLAPPGKLYP---------EASVSTAMPEVLS 125
            .|:.|      .|..|      .|..:...|  :.....::.|         |..:..:||    
Zfish    79 GDYDYHHGANGAPGAPQMYGCLNGYMDSSKLEPIYDSQARMRPVAIKQEPREEDELGDSMP---- 139

  Fly   126 GTPTNSHNKANIAMMNNVRLSNISPTLSMNGSSNEASNLHPLSMYGGSISPQSNDSGMSDSLGKY 190
              ||..|::.:            :|.||.  ..::.::....:|:   :.|              
Zfish   140 --PTYHHSQHH------------APHLSY--LQHQIAHCAQTTMH---LQP-------------- 171

  Fly   191 VPGSGYGDGMMAQSPSQGGNGPQSALTAAQKELFSQRKQREFTPDNKKDESYWDRRRRNNEAAKR 255
                  |......:|....:...|.|.....::..:.|.::..  :|....|..||.|||.|.::
Zfish   172 ------GHPTPPPTPVPSPHHQHSHLPGGSMKIGDRGKSKKHV--DKNSTEYRLRRERNNIAVRK 228

  Fly   256 SREKRRYNDMVLEQRVIELTKENHVLKAQLDAIRDKFNISGENLVSVEKILASLP 310
            ||:|.:..::..:|:||||:.:|       |.:|.:.......|.::..|...||
Zfish   229 SRDKAKMRNVETQQKVIELSADN-------DRLRKRVEHLTRELETLRGIFRQLP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 18/58 (31%)
coiled coil 239..297 CDD:269842 18/57 (32%)
cebpaNP_571960.1 bZIP_CEBPA 210..270 CDD:269859 20/66 (30%)
coiled coil 212..270 CDD:269859 19/64 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.