DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and cebpb

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_571959.2 Gene:cebpb / 140814 ZFINID:ZDB-GENE-020111-3 Length:280 Species:Danio rerio


Alignment Length:331 Identity:75/331 - (22%)
Similarity:117/331 - (35%) Gaps:111/331 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NTDTNYINNYKQDNPSNNKFPRIQAQSNNSHLQHQQQLQ-----QKLAQLHHYSQQKLSG----- 83
            |..::.:::.....|.|....::...|     :|::.:.     ..|.|..|.:.|..|.     
Zfish    18 NASSSPVSDGVCKQPVNGSMTKLHDIS-----EHEKAIDFSIYLDSLPQYQHLASQDESHRHRAL 77

  Fly    84 ---SDFPYGPRPPTGGKEEKLLLL----------APPGKL-YPEASVSTAMPEVLSGTPTNSHNK 134
               |||     ...|.|.::..|.          ..|.:| |||.. .|.:..|.|.....|..|
Zfish    78 GIYSDF-----LSEGNKSKRAALQNYKNYISLTERDPNQLAYPELQ-ETRIDAVFSPDFMGSFAK 136

  Fly   135 ANIAMMNNVRLSNISPTLSMNGSSNEASNLHPLSMYGG----SISP-QSNDSGMSDSLGKY---- 190
            :                   ||...|.    |:...||    |..| |:..||   |||..    
Zfish   137 S-------------------NGRHEET----PMDGPGGYDMRSYLPYQTAPSG---SLGNISTAS 175

  Fly   191 -----VPGSGYGDGMMAQSPSQGGNGPQSA--LTAAQKELFSQRKQREFTPDNKKDESYWDRRRR 248
                 .||:        .:||..|..||:.  :|::.|     .|:|.    :|..:.|..||.|
Zfish   176 SSCSSPPGT--------PAPSGKGRSPQAGGKMTSSGK-----GKKRL----DKDSDEYRQRRER 223

  Fly   249 NNEAAKRSREKRRYNDMVLEQRVIELTKENHVLKAQLDAIRDKFNISGENLVSVEKILASLPTSE 313
            ||.|.::||:|.:..::..:.:|:||..||..|:.:                 ||::...|.|..
Zfish   224 NNLAVRKSRDKAKMRNLETQHKVLELAAENDRLQKR-----------------VEQLSRELATLR 271

  Fly   314 QVLSNT 319
            .:||.|
Zfish   272 NLLSAT 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 16/58 (28%)
coiled coil 239..297 CDD:269842 16/57 (28%)
cebpbNP_571959.2 bZIP_CEBPB 207..277 CDD:269860 25/90 (28%)
coiled coil 214..275 CDD:269860 20/77 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.