DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and Ddit3

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:XP_030100727.1 Gene:Ddit3 / 13198 MGIID:109247 Length:182 Species:Mus musculus


Alignment Length:236 Identity:50/236 - (21%)
Similarity:79/236 - (33%) Gaps:75/236 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   501 PPPPPSAGLYVPAPSAYKDHLEAAAAWSHNVEAAVSSSAVDAVSSSSVSGSAASVLNLSRRACSP 565
            |.|.|.|   |.|..:....||..::|  .:||.. ....:.:||..:.|:..|         ||
Mouse     7 PEPGPRA---VMAAESLPFTLETVSSW--ELEAWY-EDLQEVLSSDEIGGTYIS---------SP 56

  Fly   566 SYEHMLSSTTSSTLSSASSSGAVSGDDEQEHEPAHMAPLQLQRSSPQQGSDANNCLPLKLRHKSH 630
            ..|.. .|.|.:||..||.:...       .||   .|.::.|:|                    
Mouse    57 GNEEE-ESKTFTTLDPASLAWLT-------EEP---GPTEVTRTS-------------------- 90

  Fly   631 LGDKDAAATALLSLQHIKQEPNCSRASPPAWNDGGDNSSDERDSGIS---IASAEWTAQLQRKLL 692
                              |.|.    ||.:.........:|.:.|.:   ..|.:..|:..::.:
Mouse    91 ------------------QSPR----SPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRM 133

  Fly   693 APK----EANVVTSAERDQMLKSQLERLESEVASIKMILAE 729
            ..|    |..|...||.::.||.::|||..||.:.:..|.:
Mouse   134 KEKEQENERKVAQLAEENERLKQEIERLTREVETTRRALID 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842
coiled coil 239..297 CDD:269842
Ddit3XP_030100727.1 BRLZ 114..174 CDD:197664 15/59 (25%)
coiled coil 116..166 CDD:269834 13/49 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.