DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and Dbp

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_058670.2 Gene:Dbp / 13170 MGIID:94866 Length:325 Species:Mus musculus


Alignment Length:215 Identity:59/215 - (27%)
Similarity:88/215 - (40%) Gaps:46/215 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 PRPPTGGKEEKLLLLAPPGKLYPEASVSTAMPEVLSGTPTNSHNKANIAMMNNVRLSNISPTLSM 154
            |.||            |||.|.|..|.:.        ||..|....:        .|:.||..|.
Mouse   130 PSPP------------PPGGLSPAPSPAR--------TPAPSPGPGS--------CSSSSPRSSP 166

  Fly   155 NGSSNEASNLHPLSMYGG-------SISPQSNDSGMSDSLGKYVPGSGYGDGMMAQSPSQGGNGP 212
            ..:...|:    |...||       ..:|...|....:.|..:.|..  .|..::..|......|
Mouse   167 GHAPARAT----LGAAGGHRAGLTSRDTPSPVDPDTVEVLMTFEPDP--ADLALSSIPGHETFDP 225

  Fly   213 QSALTAAQKELFSQ---RKQREF-TPDNKKDESYWDRRRRNNEAAKRSREKRRYNDMVLEQRVIE 273
            :.. ..:::||..|   :|.|:. .|:.:|||.||.||.:|||||||||:.||..:..:..|...
Mouse   226 RRH-RFSEEELKPQPIMKKARKVQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAF 289

  Fly   274 LTKENHVLKAQLDAIRDKFN 293
            |.|||.:|:.::.|:|.:.:
Mouse   290 LEKENALLRQEVVAVRQELS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 26/56 (46%)
coiled coil 239..297 CDD:269842 25/55 (45%)
DbpNP_058670.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..98
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..203 22/104 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..256 7/25 (28%)
bZIP_HLF 254..313 CDD:269843 26/56 (46%)
coiled coil 255..313 CDD:269843 25/55 (45%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 257..279 15/21 (71%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 283..297 5/13 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.