DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and AgaP_AGAP005437

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:XP_315443.3 Gene:AgaP_AGAP005437 / 1276133 VectorBaseID:AGAP005437 Length:129 Species:Anopheles gambiae


Alignment Length:123 Identity:34/123 - (27%)
Similarity:56/123 - (45%) Gaps:18/123 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 QREFTPDNKKDESYWDRRRRNNEAAKRSREKRRYNDMVLEQRVIELTKENHVLKAQLDAIRDKFN 293
            :|:.|.|.:.|| |..:|.|||:|.||||.|.:......:|||.:|..:|.:|:.::|..:.:..
Mosquito     4 KRKSTTDEEDDE-YRRKRDRNNQAVKRSRVKSKMKTEETQQRVNDLRLKNQLLEDKIDNQKKELK 67

  Fly   294 ISGENLVSVEKI----LASLPTSEQVLS-------------NTKRAKMSGSGGSSSGS 334
            ...|..::..:.    |..:..:|.:..             :.||||....|..||.|
Mosquito    68 FLKELFITQAQAKADKLVGINLNELLQDDDNDDNDEDEGEPSKKRAKEQSKGEGSSKS 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 20/58 (34%)
coiled coil 239..297 CDD:269842 20/57 (35%)
AgaP_AGAP005437XP_315443.3 bZIP 12..71 CDD:304365 20/59 (34%)
coiled coil 16..67 CDD:269834 18/50 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.