DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and Cebpg

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_034014.1 Gene:Cebpg / 12611 MGIID:104982 Length:150 Species:Mus musculus


Alignment Length:156 Identity:41/156 - (26%)
Similarity:66/156 - (42%) Gaps:43/156 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 RLSNISPTLSMNGSSNEASNLHPLSMYGGSISPQSNDSGMSDSLGKYVPGSGYGDGMMAQSPSQG 208
            :||..:.|..:||.|              .|..|::.||: ..:.:.|| :|.|.|..|..||  
Mouse     3 KLSQPATTPGVNGIS--------------VIHTQAHASGL-QQVPQLVP-AGPGGGGKAVPPS-- 49

  Fly   209 GNGPQSALTAAQKELFSQRKQREFTPDNKKDESYWDRRRRNNEAAKRSREKRRYNDMVLEQRVIE 273
                              ::.::.:|.::..:.|..||.|||.|.|:||.|.:.......|||.:
Mouse    50 ------------------KQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQ 96

  Fly   274 LTKENHVLKA-------QLDAIRDKF 292
            |.:||..|:|       :|..::|.|
Mouse    97 LKEENERLEAKIKLLTKELSVLKDLF 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 22/62 (35%)
coiled coil 239..297 CDD:269842 22/61 (36%)
CebpgNP_034014.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..94 22/88 (25%)
bZIP_CEBPG 60..120 CDD:269861 20/59 (34%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 66..93 10/26 (38%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 97..118 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..150
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.