DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and Cebpb

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_034013.1 Gene:Cebpb / 12608 MGIID:88373 Length:296 Species:Mus musculus


Alignment Length:252 Identity:57/252 - (22%)
Similarity:99/252 - (39%) Gaps:43/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AQLHHYSQQKLSGSDFPYGPRPPTGGKEEKLLLLAPPG-KLYPEASVSTAMPEVLSGTPTNSHNK 134
            |..||.....|...|  ||.:|.....:...:.|...| |..|.|......|..|...|  ....
Mouse    80 APAHHDFLSDLFADD--YGAKPSKKPADYGYVSLGRAGAKAAPPACFPPPPPAALKAEP--GFEP 140

  Fly   135 ANIAMMNNVRLSNISPTLSMNGSSNEASNLHPLSM---YGGSISPQSNDSGMSDSLGKYVPGSGY 196
            |      :.:.::.:|.::..         .|.::   .|...:|..:...:|.|.....||:  
Mouse   141 A------DCKRADDAPAMAAG---------FPFALRAYLGYQATPSGSSGSLSTSSSSSPPGT-- 188

  Fly   197 GDGMMAQSPSQGGNGPQSALTAAQKELFSQRKQREFTPDNKKDESYWDRRRRNNEAAKRSREKRR 261
                  .||:.....| :|..|......::.|.:: |.|...|| |..||.|||.|.::||:|.:
Mouse   189 ------PSPADAKAAP-AACFAGPPAAPAKAKAKK-TVDKLSDE-YKMRRERNNIAVRKSRDKAK 244

  Fly   262 YNDMVLEQRVIELTKENHVLKAQLDAIRDKFNISGENLVSVEKILASLPTSEQVLSN 318
            ..::..:.:|:|||.||..|:.:::.:       ...|.::..:...||  |.:|::
Mouse   245 MRNLETQHKVLELTAENERLQKKVEQL-------SRELSTLRNLFKQLP--EPLLAS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 19/58 (33%)
coiled coil 239..297 CDD:269842 19/57 (33%)
CebpbNP_034013.1 Required for Lys-133 sumoylation. /evidence=ECO:0000250|UniProtKB:P17676 1..22
Required for MYC transcriptional repression. /evidence=ECO:0000269|PubMed:16585579 22..104 8/25 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..199 7/36 (19%)
bZIP_CEBPB 215..285 CDD:269860 22/78 (28%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 226..246 9/19 (47%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 248..255 0/6 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.