DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and Cebpa

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001274443.1 Gene:Cebpa / 12606 MGIID:99480 Length:396 Species:Mus musculus


Alignment Length:256 Identity:62/256 - (24%)
Similarity:96/256 - (37%) Gaps:67/256 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LQQKLAQLHHYSQQKLSGSDFPYGPRPPTGGKEEKLLLLAPPGKLYPEASVSTAMPEVLSGTPTN 130
            ::|:..:.....|..|:|. |||.|.||.          .||   :|.||     |..|:.    
Mouse   195 IKQEPREEDEAKQLALAGL-FPYQPPPPP----------PPP---HPHAS-----PAHLAA---- 236

  Fly   131 SHNKANIAMMNNVRLSNISPTLSMNGSSNEASNLHPLSMYGGSISPQSNDSGMSDSLGKY-VPGS 194
            .|.:..||......: ::.|.             ||........||.:     :.:||.. :||.
Mouse   237 PHLQFQIAHCGQTTM-HLQPG-------------HPTPPPTPVPSPHA-----APALGAAGLPGP 282

  Fly   195 GYG-DGMMAQSP----SQGGNGPQSALTAAQKELFSQRKQREFTPDNKKDESYWDRRRRNNEAAK 254
            |.. .|:....|    ..||.|..:....|:|.:            :|....|..||.|||.|.:
Mouse   283 GSALKGLAGAHPDLRTGGGGGGSGAGAGKAKKSV------------DKNSNEYRVRRERNNIAVR 335

  Fly   255 RSREKRRYNDMVLEQRVIELTKENHVLKAQLDAIRDKFNISGENLVSVEKILASLPTSEQV 315
            :||:|.:..::..:|:|:|||.:|       |.:|.:.......|.::..|...||.|..|
Mouse   336 KSRDKAKQRNVETQQKVLELTSDN-------DRLRKRVEQLSRELDTLRGIFRQLPESSLV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 18/58 (31%)
coiled coil 239..297 CDD:269842 18/57 (32%)
CebpaNP_001274443.1 bZIP_CEBPA 318..378 CDD:269859 20/66 (30%)
coiled coil 320..378 CDD:269859 19/64 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.