DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and cebp1

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_571912.1 Gene:cebp1 / 114453 ZFINID:ZDB-GENE-010611-1 Length:169 Species:Danio rerio


Alignment Length:78 Identity:27/78 - (34%)
Similarity:37/78 - (47%) Gaps:12/78 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 PQSAL-TAAQKELFSQRKQREFTPDNKKDESYWDRRRRNNEAAKRSREKRRYNDMVLEQRVIELT 275
            |.||| ..|||...|           |....|..||.|||.|.::||:|.|....:.:||.::|.
Zfish    80 PASALRLCAQKRGVS-----------KDSAEYRQRRERNNIAVRKSRDKARRRIQMTQQRALQLQ 133

  Fly   276 KENHVLKAQLDAI 288
            .|||.|:..:..:
Zfish   134 DENHRLQVHIQRL 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 18/51 (35%)
coiled coil 239..297 CDD:269842 18/50 (36%)
cebp1NP_571912.1 bZIP_CEBP 96..155 CDD:269841 18/51 (35%)
coiled coil 97..155 CDD:269841 18/50 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.