DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and Cebpe

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_997014.1 Gene:Cebpe / 110794 MGIID:103572 Length:281 Species:Mus musculus


Alignment Length:270 Identity:60/270 - (22%)
Similarity:95/270 - (35%) Gaps:80/270 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 HYSQQKLSGSDFPYGPRP-----PTGGKEEKLL---LLAPPGKLYPEA---SVSTAMPEVLSGTP 128
            ||         .|..|||     .|.|.:.|.|   :.:.||...|.|   ......||...||.
Mouse    79 HY---------LPADPRPFAYPSHTFGPDRKALGPGIYSNPGSYDPRAVAVKEEPRGPEGNRGTS 134

  Fly   129 TNSHN--KANIAMMNNVRLSNISPTLSMNGSSNEASNLHPLSMYGGSISPQSNDSGMSDSLGKYV 191
            ..|:|  :..:|......: ::.|||:..|        .||.:....::                
Mouse   135 RGSYNPLQYQVAHCGQTAV-HLPPTLAAPG--------QPLRVLKAPVA---------------- 174

  Fly   192 PGSGYGDGMMAQSPSQGGNGPQSALTAAQKELFSQRKQREFTPDNKKDESYWDRRRRNNEAAKRS 256
                      |.:|      |.|.|..|........|.::..  ||....|..||.|||.|.::|
Mouse   175 ----------AAAP------PCSPLLKAPSPAGPSHKGKKAV--NKDSLEYRLRRERNNIAVRKS 221

  Fly   257 REKRRYNDMVLEQRVIELTKENHVLKAQLDAIRDKFNISGENLVSVEKILASLPTSEQVLSNTKR 321
            |:|.:...|..:|:|:|...||..|:.::|.:.       :.|.::..:...:|.:..::     
Mouse   222 RDKAKRRIMETQQKVLEYMAENERLRNRVDQLT-------QELDTLRNLFRQIPEAASLI----- 274

  Fly   322 AKMSGSGGSS 331
               .|.||.|
Mouse   275 ---KGVGGCS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 18/58 (31%)
coiled coil 239..297 CDD:269842 18/57 (32%)
CebpeNP_997014.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
bZIP_CEBPE 202..262 CDD:269863 20/66 (30%)
coiled coil 204..262 CDD:269863 19/64 (30%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 208..245 15/36 (42%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 246..267 3/27 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.