DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and CEBPE

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001796.2 Gene:CEBPE / 1053 HGNCID:1836 Length:281 Species:Homo sapiens


Alignment Length:265 Identity:55/265 - (20%)
Similarity:93/265 - (35%) Gaps:70/265 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 HYSQQKLSGSDFPYGPRPPTGGKEEKLL---LLAPPGKLYPEASVSTAMPEVLSGTPTNSHNKAN 136
            ||    |.....|:...|.|.|.:.|.|   :.:.||...|.|......|....|:...|....|
Human    79 HY----LPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYN 139

  Fly   137 -----IAMMNNVRLSNISPTLSMNGSSNEASNLHPLSMYGGSISPQSNDSGMSDSLGKYVPGSGY 196
                 :|......: ::.|||:..|........ ||:......||                    
Human   140 PLQYQVAHCGQTAM-HLPPTLAAPGQPLRVLKA-PLATAAPPCSP-------------------- 182

  Fly   197 GDGMMAQSPSQGGNGPQSALTAAQKELFSQRKQREFTPDNKKDESYWDRRRRNNEAAKRSREKRR 261
                :.::||     |...|...:|.:            ||....|..||.|||.|.::||:|.:
Human   183 ----LLKAPS-----PAGPLHKGKKAV------------NKDSLEYRLRRERNNIAVRKSRDKAK 226

  Fly   262 YNDMVLEQRVIELTKENHVLKAQLDAIRDKFNISGENLVSVEKILASLPTSEQVLSNTKRAKMSG 326
            ...:..:|:|:|...||..|:::::.:.       :.|.::..:...:|.:..::        .|
Human   227 RRILETQQKVLEYMAENERLRSRVEQLT-------QELDTLRNLFRQIPEAANLI--------KG 276

  Fly   327 SGGSS 331
            .||.|
Human   277 VGGCS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 16/58 (28%)
coiled coil 239..297 CDD:269842 16/57 (28%)
CEBPENP_001796.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
PHA03247 <62..192 CDD:223021 29/147 (20%)
bZIP_CEBPE 202..262 CDD:269863 18/66 (27%)
coiled coil 207..258 CDD:269863 16/57 (28%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 208..228 9/19 (47%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 230..237 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.