DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and CEBPD

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_005186.2 Gene:CEBPD / 1052 HGNCID:1835 Length:269 Species:Homo sapiens


Alignment Length:268 Identity:60/268 - (22%)
Similarity:104/268 - (38%) Gaps:64/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 GSDFPYGPRP---PTGGKEEKLLLLAPPGKLYPEASVSTAMPEVLSGTPTNSHNKANIAMMNNVR 144
            |:.:|..|.|   |  |:..|....|.||.|....:.:.||.:..|....:::..:..|:     
Human    14 GAPWPAEPAPFYEP--GRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAV----- 71

  Fly   145 LSNISPTL---------SMNGSSNEASNLHPLSMY-GGSISP------------QSNDSGMSDSL 187
                 |||         .:..|:::|....||.:. ||...|            :..|.|..|:.
Human    72 -----PTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAP 131

  Fly   188 GKYVPG------------SGYGDGMMAQSPSQGGNGP-QSALTAAQKELFSQRKQREFTPDNKKD 239
            |..:|.            :..|......||....:.| |:......:|..:.::    .||....
Human   132 GSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKR----GPDRGSP 192

  Fly   240 ESYWDRRRRNNEAAKRSREKRRYNDMVLEQRVIELTKENHVLKAQLDAI-RDKFNISGENLVSVE 303
            | |..||.|||.|.::||:|.:..:..::|:::||:.||..|..:::.: ||        |..:.
Human   193 E-YRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRD--------LAGLR 248

  Fly   304 KILASLPT 311
            :....||:
Human   249 QFFKQLPS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 19/59 (32%)
coiled coil 239..297 CDD:269842 19/58 (33%)
CEBPDNP_005186.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48 11/35 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..133 8/35 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..219 19/72 (26%)
bZIP_CEBPD 188..252 CDD:269862 21/72 (29%)
coiled coil 191..249 CDD:269862 20/66 (30%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 195..222 9/26 (35%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 226..254 7/35 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.