DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vri and Nfilz

DIOPT Version :9

Sequence 1:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster
Sequence 2:XP_038936507.1 Gene:Nfilz / 102546838 RGDID:7708626 Length:276 Species:Rattus norvegicus


Alignment Length:311 Identity:89/311 - (28%)
Similarity:128/311 - (41%) Gaps:86/311 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 DGMMAQSPSQGGN--------GPQSALTAAQKELFSQRKQREFTPDNKKDESYWDRRRRNNEAAK 254
            ||:  ..|:||.:        ||            :.|:||||.|:.|||..||::||:||||||
  Rat     4 DGL--SIPNQGPSKVFWGTRRGP------------TTRRQREFMPEEKKDTVYWEKRRKNNEAAK 54

  Fly   255 RSREKRRYNDMVLEQRVIELTKENHVLKAQLDAIRDKF----NISGENLVSVEKILASLPTSEQV 315
            |||||||.||:.:|.|:..|.:||.||:|:|.|::.:|    ::.|..::.::.:|         
  Rat    55 RSREKRRLNDVAIEGRLAMLLEENAVLRAELQALKLQFGLLPSMCGSRMLPLQALL--------- 110

  Fly   316 LSNTKRAKMSGSGGSSSGSS-----PSGSG---------SGEGSPQG--GHNGYP---------- 354
                  .|.|.:|.|.||:.     |.|.|         ||.....|  ...|:|          
  Rat   111 ------WKSSWTGESHSGADSFLPLPGGHGCLFKPYSVDSGIPGCSGCLVAQGWPGLSASSRFLQ 169

  Fly   355 VGPPLSPLIYGPNGNARPEATVKSVHHI-HHAGVAPPPTHLQQLVVPQSQT-QHLYQPQPQQHQP 417
            ...|||..|.....:|....||...|.: .|.|..           |:.:| ..|:.|.|.....
  Rat   170 ESEPLSHRIVDRAFHAAFPDTVFGCHFLDRHVGTR-----------PELKTCCGLWSPVPTGSHA 223

  Fly   418 HQQQQISQPPQQQQQQQEPS---PSAGSSS---PVISDPHNRPPSTTIANL 462
            .....||....:......||   |..|:.|   ..||.||.....:.:::|
  Rat   224 PGYSGISMASSESSMGFSPSMTCPVPGNRSEGLAQISLPHKLRIKSQLSSL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 32/62 (52%)
coiled coil 239..297 CDD:269842 31/61 (51%)
NfilzXP_038936507.1 bZIP_NFIL3 38..95 CDD:269842 32/56 (57%)
coiled coil 42..93 CDD:269842 29/50 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1450431at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.