DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bub1 and MAD3

DIOPT Version :9

Sequence 1:NP_001285621.1 Gene:Bub1 / 33758 FlyBaseID:FBgn0031696 Length:1099 Species:Drosophila melanogaster
Sequence 2:NP_012521.3 Gene:MAD3 / 853439 SGDID:S000003550 Length:515 Species:Saccharomyces cerevisiae


Alignment Length:125 Identity:31/125 - (24%)
Similarity:58/125 - (46%) Gaps:8/125 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DPLDHWYNYICWYEN---HAQSDPELKYRETLERCLTVYEHNDYYRQDVRLVRLWLKYIAMQT-- 113
            ||:..:..||.|..|   ...:..:......|||||:..:..:.||.|||.:::|..||.:.|  
Yeast    76 DPITLYLEYIKWLNNAYPQGGNSKQSGMLTLLERCLSHLKDLERYRNDVRFLKIWFWYIELFTRN 140

  Fly   114 ---DPLHFYQVLFQRGTGRQVAAFYIGWAAYYESREEYKDAEAVFNLAFQEKAQSTSELQ 170
               :....:..:.:.|.|.::|:||..:......:|:::.|..:..|..:.||:....|:
Yeast   141 SFMESRDIFMYMLRNGIGSELASFYEEFTNLLIQKEKFQYAVKILQLGIKNKARPNKVLE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bub1NP_001285621.1 Mad3_BUB1_I 38..158 CDD:214817 27/111 (24%)
STKc_Bub1_BubR1 813..1096 CDD:270883
MAD3NP_012521.3 Mad3_BUB1_I 57..188 CDD:214817 27/111 (24%)
Mad3_BUB1_II 330..397 CDD:400476
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I2369
eggNOG 1 0.900 - - E1_KOG1166
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9184
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14030
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.