DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and ERG5

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_013728.1 Gene:ERG5 / 855029 SGDID:S000004617 Length:538 Species:Saccharomyces cerevisiae


Alignment Length:417 Identity:97/417 - (23%)
Similarity:171/417 - (41%) Gaps:88/417 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 AEEIFQSTKIT---TKNMSYELIRP----FLGDGLLISIDQKWHT-RRKTLTPAFHFNILQSFL- 159
            |.:|.||:|..   ..:::.:::||    ||        |.|.|| .||:|...|....|..:| 
Yeast   124 ARKILQSSKFVKPCVVDVAVKILRPCNWVFL--------DGKAHTDYRKSLNGLFTKQALAQYLP 180

  Fly   160 ---SIFKEESKKFIKILDKN-----VGFELELNQIIPQFTLNNICETALGVKLDDMSEGN----- 211
               .|..:...||:::..:|     |.|. |:.:|:...:||:.|             ||     
Yeast   181 SLEQIMDKYMDKFVRLSKENNYEPQVFFH-EMREILCALSLNSFC-------------GNYITED 231

  Fly   212 EYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYSRILRTIHG-----FSSGIIQRKRQQFK 271
            :.||...|:.:|     ...|...|  |.:...|.|      |.:|     .:..|.:...|..|
Yeast   232 QVRKIADDYYLV-----TAALELVN--FPIIIPYTK------TWYGKKTADMAMKIFENCAQMAK 283

  Fly   272 Q------KQLGQVDEFGKKQRYAMLDTLLAAEAEGKIDH-----QGICDEVNTFMFGGYDTTSTS 325
            .      |.:..:|.:.|    .|.|...:.:.:.:|.|     :.|.:.|.||:|...|.:|:.
Yeast   284 DHIAAGGKPVCVMDAWCK----LMHDAKNSNDDDSRIYHREFTNKEISEAVFTFLFASQDASSSL 344

  Fly   326 LIFTLLLLALHADVQERCYEE-LQDLPEDID-EVSMFQFNELIHLECVIKESLRLFPSAPIIGRT 388
            ..:...::|...||..:..|| |.....|:. |:::....::.:...||||:||..|  |::...
Yeast   345 ACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYRP--PVLMVP 407

  Fly   389 CIEES---VMNGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPENSVNRHPFAFVPFSAG 450
            .:.:.   |......||.|.:...:|..:.|...:..|::|:|||::..:..:.....::.|..|
Yeast   408 YVVKKNFPVSPNYTAPKGAMLIPTLYPALHDPEVYENPDEFIPERWVEGSKASEAKKNWLVFGCG 472

  Fly   451 PRNCIGQKFGVLEIKVLLAAVIRNFKL 477
            |..|:||.:    :.:..||::..|.|
Yeast   473 PHVCLGQTY----VMITFAALLGKFAL 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 97/417 (23%)
ERG5NP_013728.1 CYP61_CYP710 103..522 CDD:410703 97/417 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.