DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP704B1

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_177109.3 Gene:CYP704B1 / 843283 AraportID:AT1G69500 Length:524 Species:Arabidopsis thaliana


Alignment Length:494 Identity:119/494 - (24%)
Similarity:208/494 - (42%) Gaps:112/494 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SKVFVVPGKTRFGNNLDLLNLTPANIFSYIR-----ESTAKANGQNYIWNFLFAPEYNIVRAEDA 104
            |:..|||              .|...::||.     |...|.|..||                  
plant    58 SRTVVVP--------------MPFTTYTYIADPINVEYVLKTNFSNY------------------ 90

  Fly   105 EEIFQSTKITTKNMSY-ELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLS-IFKEESK 167
                      .|..:| ..:...||||:..|..:.|..:|||.:..|....|:.|.: :|||.|.
plant    91 ----------PKGETYHSYMEVLLGDGIFNSDGELWRKQRKTASFEFASKNLRDFSTVVFKEYSL 145

  Fly   168 KFIKILDKNVGF---ELELNQIIPQFTLNNICETALGVKLDDMS---EGNEYRKAIHDFEIVFNQ 226
            |...||.: ..|   ::::.:::.:.||::||:...||::..::   ..|.:.||.....|:...
plant   146 KLFTILSQ-ASFKEQQVDMQELLMRMTLDSICKVGFGVEIGTLAPELPENHFAKAFDTANIIVTL 209

  Fly   227 RMCNPLMFFNW---YFFLFGDYKKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYA 288
            |..:||    |   .|...|......:.::.::.|:..:|:|::.:..:.|:...:.........
plant   210 RFIDPL----WKMKKFLNIGSEALLGKSIKVVNDFTYSVIRRRKAELLEAQISPTNNNNNNNNKV 270

  Fly   289 MLDTL-----LAAEAEGKIDHQGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQ 348
            ..|.|     ::.:.:.|...:.:.|.|..|:..|.|||:|:|.:.:.::.::.:|.|:.|.|||
plant   271 KHDILSRFIEISDDPDSKETEKSLRDIVLNFVIAGRDTTATTLTWAIYMIMMNENVAEKLYSELQ 335

  Fly   349 DLPEDIDE---VSMFQ--------FNE----------------LIHLECVIKESLRLFPSAPIIG 386
            :|.::..|   .|:.|        |||                |.:|..||.|:|||:|:.|...
plant   336 ELEKESAEATNTSLHQYDTEDFNSFNEKVTEFAGLLNYDSLGKLHYLHAVITETLRLYPAVPQDP 400

  Fly   387 RTCIEESVM-NGLVLPKNAQISIHIYDIMR-------DARHFPKPNQFLPERFLPENSV-NRHPF 442
            :..:|:.:: ||..:.....::...|.:.|       ||.      .|.|||:|.:... |..||
plant   401 KGVLEDDMLPNGTKVKAGGMVTYVPYSMGRMEYNWGSDAA------LFKPERWLKDGVFQNASPF 459

  Fly   443 AFVPFSAGPRNCIGQKFGVLEIKVLLAAVIR--NFKLLP 479
            .|..|.||||.|:|:....|::|:.:|.:.|  .|.|:|
plant   460 KFTAFQAGPRICLGKDSAYLQMKMAMAILCRFYKFHLVP 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 116/488 (24%)
CYP704B1NP_177109.3 PLN03195 1..524 CDD:215627 119/494 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.