DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP702A1

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_176744.1 Gene:CYP702A1 / 842878 AraportID:AT1G65670 Length:482 Species:Arabidopsis thaliana


Alignment Length:467 Identity:97/467 - (20%)
Similarity:174/467 - (37%) Gaps:106/467 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 YNIVRAEDAEEIFQ-STKITTKNMSY-ELIRPFL-GDGLLIS--IDQKWHTRRKTLTPAFHFNIL 155
            :..::..||   || .|.|..:.:.| .:.|..| |..::||  |:......:....|....:|.
plant    49 FEFMKPHDA---FQFPTFIKERIIRYGPIFRTSLFGAKVIISTDIELNMEIAKTNHAPGLTKSIA 110

  Fly   156 QSF----LSIFKEESKKFIKILDKNV----GFELELNQIIPQFTLNNICETA----LGVK----- 203
            |.|    |....:||.|.::.|...:    |.:|.:.|.|...|..::.|.|    |.||     
plant   111 QLFGENNLFFQSKESHKHVRNLTFQLLGSQGLKLSVMQDIDLLTRTHMEEGARRGCLDVKEISSK 175

  Fly   204 -----LDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLF-----GDYKKYSRILRTIHGF 258
                 |.....|:...:|..:..:.:.   |.|   ..|:.|..     |.||......|.:|..
plant   176 ILIECLAKKVTGDMEPEAAKELALCWR---CFP---SGWFRFPLNLPGTGVYKMMKARKRMLHLL 234

  Fly   259 SSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEGKIDHQGICDEVNTFMFGGYDTTS 323
            ...|::::.   ..::||   ||.|          :..|....:......:.:.|......:||.
plant   235 KETILKKRA---SGEELG---EFFK----------IIFEGAETMSVDNAIEYIYTLFLLANETTP 283

  Fly   324 TSLIFTLLLLALHADVQERCYEELQDL----PEDIDEVSMFQFNELIHLECVIKESLRLFPSAPI 384
            ..|..|:.|::.:..|.:..:.|.:.:    .|....::..::..:...:.||.||||:..:||.
plant   284 RILAATIKLISDNPKVMKELHREHEGIVRGKTEKETSITWEEYKSMTFTQMVINESLRITSTAPT 348

  Fly   385 IGRTCIEESVMNGLVLP--------KNAQISIHIYDIMRDARHFPKPNQFLPERFLPEN---SVN 438
            :.|....|..:....:|        .|...:...||         .|..|.|.|:..::   .|:
plant   349 VFRIFDHEFQVGSYKIPAGWIFMGYPNNHFNPKTYD---------DPLVFNPWRWEGKDLGAIVS 404

  Fly   439 RHPFAFVPFSAGPRNCIGQKFGVLEIKVLL-------------AAVIRNFKLLPATQLEDLTFEN 490
            |   .::||.||.|.|:|.:|..|::.:.:             ..::|||.|:         |.|
plant   405 R---TYIPFGAGSRQCVGAEFAKLQMAIFIHHLSRDRWSMKIGTTILRNFVLM---------FPN 457

  Fly   491 GIVLRTQQNIKV 502
            |..::..::.:|
plant   458 GCEVQFLKDTEV 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 97/467 (21%)
CYP702A1NP_176744.1 p450 8..440 CDD:386267 89/427 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.