DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP96A3

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_176713.1 Gene:CYP96A3 / 842842 AraportID:AT1G65340 Length:503 Species:Arabidopsis thaliana


Alignment Length:554 Identity:120/554 - (21%)
Similarity:208/554 - (37%) Gaps:145/554 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WIALLGSSLLIGALWLLLRQLNKTY-FILSLCKRVRTADGSPLESKVFVVPGKTRFGNNLDLLNL 65
            |.||       |.|..||.|:.:.| :|..:.:..         ...|...|....|.:: ||.:
plant    37 WPAL-------GMLPGLLLQVPRIYDWITEVLEAT---------DMTFCFKGPCLSGMDI-LLTV 84

  Fly    66 TPANIFSYIRESTAKANGQNYIWNFLFAPEYNIVRAEDAEEIFQSTKITTKNMSYELIRPFLGDG 130
            .|.|| .||..|    |..||                            .|.|.::.|...:||.
plant    85 DPVNI-HYILSS----NFANY----------------------------PKGMEFKKIFEVVGDS 116

  Fly   131 LLISIDQKWHTRRKTLTPAFHFNILQSF--LSIFKEESKKFIKIL----DKNVGFELELNQIIPQ 189
            :.......|...|.:....|.....|.|  .:..::..:..:.||    |||:  .::|..:..:
plant   117 IFNVDSGLWEDMRNSSHAIFSNQDFQMFWVSTSVRKLRQGLVPILENAADKNI--LVDLQDLFQR 179

  Fly   190 FTLNNICETAL--------------------GVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMF 234
            |    :.:|:|                    |..:|.:|:|..||..             .|:  
plant   180 F----LFDTSLILMTGYDPKCLSVEMPKVEFGDAVDGVSDGVFYRHV-------------KPV-- 225

  Fly   235 FNW---YFFLFGDYKKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQ----------- 285
            |.|   |....|..|:..|.|.........||..||:        :::..|...           
plant   226 FLWRLQYLIGVGVEKRLKRGLAVFDQLLEKIITAKRE--------EINSHGTHHPSRGEAIDVLT 282

  Fly   286 RYAMLDTLLAAEAEGKIDHQGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDL 350
            .|..:||......|.. |.:.|.|.:..|:....||||::|.:...|::.:.:...:..:|:...
plant   283 YYMTMDTTKYKYLEPS-DDRFIKDTILGFLIAARDTTSSALTWFFWLMSKNPEAINKIRQEVNKK 346

  Fly   351 PEDIDEVSMFQFNELIHLECVIKESLRLFPSAPIIGRTCIEESVM-NGLVLPKNAQISIHIYDIM 414
            ....|...:   .:|::|...:.|:|||:|..|...::..:..|: :|..:.:..:|.|.:|.:.
plant   347 MPRFDPADL---EKLVYLHGAVCETLRLYPPVPFNHKSPAKPDVLPSGHRVDEKWKIVISMYALG 408

  Fly   415 R-------DARHFPKPNQFLPERFLPENSVNRH--PFAFVPFSAGPRNCIGQKFGVLEIKVLLAA 470
            |       ||      ..|.|||::.::...:|  .:.|:.|:||||.|:|:|...|::|.:.|.
plant   409 RMKSVWGDDA------EDFRPERWISDSGRLKHEPSYKFLAFNAGPRACLGKKLTFLQMKTVAAE 467

  Fly   471 VIRNF--KLLPATQLEDLTFENGIVLRTQQNIKV 502
            :|||:  |::...:.|.:.   .::.|.|..:||
plant   468 IIRNYDIKVVEGHKTEPVP---SVLFRMQHGLKV 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 109/504 (22%)
CYP96A3NP_176713.1 p450 22..502 CDD:386267 120/554 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.